close all open/close all

CDS information : Ncarz_00200


close this sectionLocation

Organism
StrainATCC 15944
Entry nameNeocarzinostatin
Contig
Start / Stop / Direction38,906 / 37,422 / - [in whole cluster]
38,906 / 37,422 / - [in contig]
Locationcomplement(37422..38906) [in whole cluster]
complement(37422..38906) [in contig]
TypeCDS
Length1,485 bp (494 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative drug resistance transporter
Product (GenBank)transmembrane transporter
GenencsA1
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15797213] The neocarzinostatin biosynthetic gene cluster from Streptomyces carzinostaticus ATCC 15944 involving two iterative type I polyketide synthases. (Chem Biol. , 2005)
Related Reference
ACC
Q9WVV3
PmId
[10198016] Mitomycin resistance in Streptomyces lavendulae includes a novel drug-binding-protein-dependent export system. (J Bacteriol. , 1999)

close this sectionSequence

selected fasta
>putative drug resistance transporter [transmembrane transporter]
MNPDVAADGAEDPQAKADPRRWWVLALLSGLQFMILLDMTVVNVALPLVQEGLGFSEAGL
TWVVNGYVLAAGGLLILGGRLADVFGRRRLLLIGVGIFAASSAVCGAAVVPGMMVVGRFA
QGTAEAIAAPASLGLIALLFTDPKERNKALGIWGGLVALGGTLGYIVSGVLTDLTSWRWI
FYINLPVALAVLLVIPRMVTESRMERERDQGLDIAGAVTSTAGLVAIVYGLLQAAEHPWE
SASVVLPLAGGIALLLAMLIIERRVENPLIPLDFFANRTRSVINLTSLFFMAAFISYTFI
LTLFEQHVLKYSPLETGLAYLPLGFGIGIGIGVGTALTPRIGVRAVVAMGFIGAGIGLLL
TSTVDVDTRYAGGILPGMVVFGVFAGATMPAATSAALHQVTDQNSSLASGVQNTMQQIGG
ALGLAVLVPLAIRYTTSEIQAGVPVETAVTSGYVLAFRVGAALMIIGGVLIMALFERVDP
ALRDPTSEIVAQTR
selected fasta
>putative drug resistance transporter [transmembrane transporter]
GTGAACCCCGATGTGGCCGCGGACGGCGCCGAGGACCCTCAGGCGAAGGCGGATCCTCGG
CGCTGGTGGGTACTGGCCCTGCTCTCCGGCCTGCAGTTCATGATCCTTCTGGACATGACC
GTCGTGAACGTGGCGCTGCCGCTTGTCCAGGAGGGTCTCGGCTTCTCGGAGGCAGGCCTG
ACCTGGGTGGTCAACGGGTATGTGCTGGCGGCCGGAGGCCTGCTGATCCTCGGTGGCCGT
CTGGCCGACGTCTTCGGCCGGCGGCGCCTGCTGCTGATCGGCGTCGGCATCTTTGCGGCG
TCTTCGGCCGTGTGCGGCGCGGCCGTCGTTCCCGGGATGATGGTCGTGGGCCGGTTCGCC
CAGGGAACCGCCGAGGCCATCGCAGCCCCCGCGTCACTCGGATTGATCGCGCTGCTCTTC
ACCGACCCGAAGGAACGCAACAAGGCCCTCGGTATCTGGGGCGGACTCGTGGCGCTGGGT
GGGACCCTGGGATACATCGTCTCCGGAGTGCTGACTGACCTGACGTCCTGGCGCTGGATC
TTCTACATCAACCTGCCGGTGGCCCTGGCCGTGCTGCTGGTCATCCCGCGGATGGTCACC
GAGAGCCGGATGGAGCGCGAGAGGGACCAGGGGCTCGACATCGCCGGCGCGGTCACCTCG
ACCGCGGGGCTCGTGGCCATCGTCTACGGACTGCTGCAGGCCGCCGAGCACCCCTGGGAG
TCGGCCTCCGTGGTGCTACCGCTCGCCGGTGGCATCGCCCTGCTGCTCGCCATGCTCATC
ATCGAGCGCCGCGTCGAGAACCCGCTCATCCCGCTGGACTTCTTCGCCAACCGGACCAGG
TCGGTCATCAACCTGACCTCCCTGTTCTTCATGGCGGCGTTCATCTCGTACACCTTCATC
CTGACGTTGTTCGAGCAGCACGTGCTGAAGTACTCGCCGCTCGAGACCGGCCTGGCGTAC
CTCCCCCTCGGATTCGGCATCGGTATCGGCATCGGGGTGGGGACCGCGCTGACCCCGCGC
ATCGGAGTGCGGGCGGTCGTGGCGATGGGCTTCATCGGCGCCGGGATCGGACTGCTGCTG
ACGAGCACGGTCGATGTCGACACTCGCTATGCCGGAGGGATCCTGCCGGGAATGGTCGTG
TTCGGCGTATTCGCGGGCGCCACCATGCCGGCCGCGACGAGCGCCGCCCTCCACCAGGTC
ACCGACCAGAACTCAAGCCTCGCCTCGGGCGTCCAGAACACCATGCAGCAGATTGGAGGA
GCCCTGGGGCTCGCCGTTCTGGTACCTCTGGCCATCCGGTACACCACCAGTGAGATCCAG
GCCGGTGTCCCCGTCGAGACCGCAGTGACGTCGGGGTATGTCCTGGCCTTCCGGGTGGGA
GCAGCGCTGATGATCATCGGCGGTGTCCTGATCATGGCGCTCTTCGAACGGGTGGACCCG
GCACTGCGCGACCCGACCTCCGAGATCGTGGCCCAGACGCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001411 Tetracycline resistance protein TetB/drug resistance transporter (Family)
 [27-51]  4.89999951782359e-05 PR01036 [87-109]  4.89999951782359e-05 PR01036 [149-173]  4.89999951782359e-05 PR01036
PR01036   TCRTETB
IPR005829 Sugar transporter, conserved site (Conserved_site)
 [78-94]  PS00216
PS00216   SUGAR_TRANSPORT_1
IPR011701 Major facilitator superfamily (Family)
 [31-423]  8.00000000000001e-52 PF07690
PF07690   MFS_1
IPR016196 Major facilitator superfamily domain, general substrate transporter (Domain)
 [1-474]  4.50001022902825e-75 SSF103473
SSF103473   MFS_gen_substrate_transporter
IPR020846 Major facilitator superfamily domain (Domain)
 [24-479]  PS50850
PS50850   MFS
SignalP No significant hit
TMHMM
 [21-43]  Transmembrane (i-o) [58-77]  Transmembrane (o-i) [90-112]  Transmembrane (i-o) [122-141]  Transmembrane (o-i) [150-172]  Transmembrane (i-o) [177-199]  Transmembrane (o-i) [212-234]  Transmembrane (i-o) [244-261]  Transmembrane (o-i) [282-304]  Transmembrane (i-o) [314-336]  Transmembrane (o-i) [341-360]  Transmembrane (i-o) [375-397]  Transmembrane (o-i) [418-437]  Transmembrane (i-o) [452-474]  Transmembrane (o-i)
Transmembrane 14