close all open/close all

CDS information : Ncarz_00210


close this sectionLocation

Organism
StrainATCC 15944
Entry nameNeocarzinostatin
Contig
Start / Stop / Direction39,459 / 40,076 / + [in whole cluster]
39,459 / 40,076 / + [in contig]
Location39459..40076 [in whole cluster]
39459..40076 [in contig]
TypeCDS
Length618 bp (205 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative TetR family transcriptional regulator
Product (GenBank)transcriptional regulator
GenencsR4
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15797213] The neocarzinostatin biosynthetic gene cluster from Streptomyces carzinostaticus ATCC 15944 involving two iterative type I polyketide synthases. (Chem Biol. , 2005)
Family/Domain
FD
IPR001647

close this sectionSequence

selected fasta
>putative TetR family transcriptional regulator [transcriptional regulator]
MIRDAHPYHRPGLRSALIEAGLKRARKGGADALGLREITRSVGVTPNAAYRHFADRRELV
LAVAAQAQDKLAQAMLDRMQDVVDQADPAAHAVQKLRGVGLGYIHFALSEPGWFELAILL
QEEPSGESEARVPPPYQLLLDALDGMVEAGALTPERRVDAEWVCWSGVHGFADLATRGPL
RRQDRTVVDKLAVHVVNTVISELKA
selected fasta
>putative TetR family transcriptional regulator [transcriptional regulator]
ATGATCCGTGACGCGCATCCCTATCACCGCCCGGGCCTGAGGTCCGCGCTCATCGAAGCC
GGTCTGAAGCGTGCCCGGAAGGGGGGCGCCGACGCACTCGGGCTCCGGGAGATCACCCGG
TCCGTGGGAGTCACGCCGAACGCCGCCTACCGGCATTTCGCAGACCGGCGCGAGCTCGTG
CTCGCCGTCGCCGCCCAGGCACAGGACAAACTGGCGCAGGCCATGCTCGACCGCATGCAG
GACGTCGTGGACCAGGCGGACCCCGCTGCCCACGCGGTGCAAAAGCTGCGCGGAGTCGGC
CTCGGCTACATCCACTTCGCACTGTCCGAACCGGGTTGGTTCGAGCTGGCGATCCTGCTC
CAAGAAGAGCCCAGCGGCGAGTCCGAGGCGCGTGTACCACCGCCCTACCAACTCCTGCTC
GACGCCCTCGACGGCATGGTCGAGGCAGGCGCGTTGACTCCCGAGAGACGAGTGGACGCC
GAGTGGGTCTGCTGGTCGGGGGTCCACGGATTCGCCGATCTGGCGACCCGCGGCCCGTTG
CGCCGACAGGACCGTACAGTCGTGGACAAACTCGCCGTCCACGTCGTGAACACCGTCATC
AGCGAACTCAAAGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001647 DNA-binding HTH domain, TetR-type (Domain)
 [17-63]  3e-09 PF00440
PF00440   TetR_N
 [11-71]  PS50977
PS50977   HTH_TETR_2
IPR009057 Homeodomain-like (Domain)
 [9-87]  3.70000251046782e-13 SSF46689
SSF46689   Homeodomain_like
IPR011075 Tetracycline transcriptional regulator, TetR-related, C-terminal (Domain)
 [90-204]  6.39998633403535e-20 SSF48498
SSF48498   TetR_like_C
IPR015893 Tetracycline transcriptional regulator, TetR-like, C-terminal (Domain)
 [8-195]  1.5e-32 G3DSA:1.10.357.10
G3DSA:1.10.357.10   TetR_C
IPR025996 WHG domain (Domain)
 [97-180]  3.5e-14 PF13305
PF13305   WHG
SignalP No significant hit
TMHMM No significant hit