close all open/close all

CDS information : Ncarz_00220


close this sectionLocation

Organism
StrainATCC 15944
Entry nameNeocarzinostatin
Contig
Start / Stop / Direction40,368 / 41,744 / + [in whole cluster]
40,368 / 41,744 / + [in contig]
Location40368..41744 [in whole cluster]
40368..41744 [in contig]
TypeCDS
Length1,377 bp (458 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)oxidase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15797213] The neocarzinostatin biosynthetic gene cluster from Streptomyces carzinostaticus ATCC 15944 involving two iterative type I polyketide synthases. (Chem Biol. , 2005)
Related Reference
ACC
Q9FUJ3
PmId
[14555694] Cytokinin-deficient transgenic Arabidopsis plants show multiple developmental alterations indicating opposite functions of cytokinins in the regulation of shoot and root meristem activity. (Plant Cell. , 2003)

close this sectionSequence

selected fasta
>putative oxidoreductase [oxidase]
MPSGTFKDQARAVGPAGSRLVTGILSRSGPFSRLGLPLLRGTLSTRDSDLTAAARDFGNR
IHLRPVAVLHPADAEDVATIVRFGRENGFAVVPRGAACSVDGQAQTSDGIVVDLSSLSAV
GEPAPSLVRVDGGARWRAVLEATLPCGRVPLVVPDHLGLSVGGTLSVGGIGGTSHRYGSV
ADNVLELEVVTASGDLLTCSPVRRPELFDAVRGSLGRYGIITGATLALTGARSSARTYRL
VYHDCAAFLADQQRLVHERRFEHVEGHAHRSGTSGWLFVLEAMQSFDTPHEPDDTALLEG
LTHHHVDTIETVSYRDFLGRVAPLEARQRALGSWQHHPHPRCNVLLPGLEAEALITRTLA
GLTEEDIGPGGSVLLYPIPTARLAAPHVPKARDALTVVFGLQRTAPPDQPELLDRMVRDN
LALRAAARKAGGADYAYAATHCEAPDAYESFGRTPQSR
selected fasta
>putative oxidoreductase [oxidase]
GTGCCAAGTGGCACCTTCAAGGACCAAGCAAGAGCAGTCGGACCCGCGGGGAGTCGCCTC
GTGACCGGCATCCTCTCCCGGTCCGGGCCCTTCTCCCGTCTGGGCCTGCCGCTCCTCCGC
GGGACCCTCAGCACACGCGACAGCGACCTCACCGCTGCGGCACGGGACTTCGGCAACCGC
ATACACCTCAGGCCCGTGGCCGTGCTGCATCCCGCCGATGCCGAGGACGTCGCGACGATC
GTGCGCTTCGGCCGGGAGAACGGGTTCGCGGTGGTCCCCCGGGGTGCGGCCTGCTCGGTG
GACGGCCAGGCGCAGACATCGGACGGGATCGTGGTCGATCTCTCCTCGCTCTCCGCCGTC
GGTGAGCCGGCCCCCAGCCTCGTACGCGTGGACGGCGGTGCACGATGGCGGGCGGTCCTC
GAGGCCACCCTGCCGTGCGGCCGTGTCCCACTCGTGGTACCCGACCATCTCGGCCTGTCC
GTCGGCGGGACACTGTCGGTCGGCGGGATCGGCGGCACGAGCCACCGGTACGGCAGCGTC
GCCGACAACGTGCTCGAACTCGAGGTCGTCACCGCGAGCGGAGACCTTCTCACCTGCTCG
CCCGTCAGACGCCCTGAACTCTTCGATGCTGTAAGGGGGAGCCTGGGCCGGTACGGAATC
ATCACCGGTGCCACCCTCGCACTCACCGGGGCGAGGAGTTCGGCGCGGACGTACCGACTC
GTCTATCACGATTGCGCTGCATTCCTCGCGGACCAGCAACGGCTGGTCCACGAGAGACGG
TTCGAGCACGTGGAGGGGCACGCCCACCGCTCCGGAACGTCGGGCTGGCTGTTCGTCCTC
GAGGCGATGCAGTCCTTCGACACACCGCACGAGCCCGACGACACCGCGCTGCTCGAGGGC
CTCACTCACCATCACGTCGACACGATCGAGACCGTCTCCTACCGCGACTTCCTGGGCCGG
GTCGCGCCACTCGAAGCCCGGCAGAGAGCGCTCGGCTCGTGGCAGCACCACCCACACCCG
CGGTGCAACGTCCTCCTGCCGGGCCTGGAAGCGGAAGCGCTCATCACAAGGACTCTGGCC
GGTCTCACCGAGGAGGACATCGGACCGGGAGGGAGCGTTCTCCTCTATCCCATCCCCACC
GCCCGTCTCGCAGCGCCGCATGTTCCAAAGGCGCGCGACGCCCTGACCGTCGTCTTCGGG
CTCCAGCGGACGGCACCTCCAGACCAGCCCGAACTGCTGGACCGCATGGTGCGTGACAAC
CTCGCGCTGCGGGCGGCGGCCAGGAAAGCGGGGGGCGCTGACTACGCGTACGCGGCGACG
CACTGCGAAGCCCCGGACGCCTACGAGTCGTTCGGCCGGACCCCGCAGTCCCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006094 FAD linked oxidase, N-terminal (Domain)
 [65-200]  2.7e-29 PF01565
PF01565   FAD_binding_4
IPR015345 Cytokinin dehydrogenase 1, FAD/cytokinin binding domain (Domain)
 [273-453]  9.10000000000001e-10 PF09265
PF09265   Cytokin-bind
IPR016164 FAD-linked oxidase-like, C-terminal (Domain)
 [232-453]  1.49999648196323e-33 SSF55103
SSF55103   FAD-binding_2
IPR016166 FAD-binding, type 2 (Domain)
 [36-231]  9.90001804798395e-47 SSF56176
SSF56176   FAD-binding_2
 [61-231]  PS51387
PS51387   FAD_PCMH
IPR016167 FAD-binding, type 2, subdomain 1 (Domain)
 [41-117]  5.69999999999999e-15 G3DSA:3.30.43.10
G3DSA:3.30.43.10   FAD-binding_2_sub1
IPR016168 FAD-linked oxidase, FAD-binding, subdomain 2 (Domain)
 [126-229]  3.8e-12 G3DSA:3.30.465.20
G3DSA:3.30.465.20   FAD-linked_oxidase_FAD-bd_sub2
SignalP No significant hit
TMHMM No significant hit