close all open/close all

CDS information : Ncarz_00230


close this sectionLocation

Organism
StrainATCC 15944
Entry nameNeocarzinostatin
Contig
Start / Stop / Direction43,114 / 41,951 / - [in whole cluster]
43,114 / 41,951 / - [in contig]
Locationcomplement(41951..43114) [in whole cluster]
complement(41951..43114) [in contig]
TypeCDS
Length1,164 bp (387 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productepoxide hydrolase
Product (GenBank)epoxide hydrolase
GenencsF2
Gene (GenBank)
EC number
Keyword
  • enediyne core
  • retaining type
Note
Note (GenBank)
Reference
ACC
PmId
[15797213] The neocarzinostatin biosynthetic gene cluster from Streptomyces carzinostaticus ATCC 15944 involving two iterative type I polyketide synthases. (Chem Biol. , 2005)
[20704329] Characterization of the epoxide hydrolase NcsF2 from the neocarzinostatin biosynthetic gene cluster. (Org Lett. , 2010)
[23844627] Predictive model for epoxide hydrolase-generated stereochemistry in the biosynthesis of nine-membered enediyne antitumor antibiotics. (Biochemistry. , 2013)

close this sectionSequence

selected fasta
>epoxide hydrolase [epoxide hydrolase]
MEPFRIVIPQADLDDLHRRLDATRWPSEIPGTGWSRGVPLDYLKELVGYWRDGYDWRAAE
DRLNTVPQFTTEIDGTNVHFMHIRSAEPDALPMIITHGWPGSVAEFLDVIDPLTNPRAHG
GDPADAFHLVIPSLPGFGFSGPTPEPGWNLPRVASAWAELMRRLGYSRYAVQGGDLGAWT
SLTLSGVDHEHVVGTHVNFLITPPSGDPADLAGLGEQDLARLQLLAEFGAEGSGYMKIQS
TRPQTLSYSLTDSPVGQLAWVVEKFMEWGDTDKSPEDAVDRDRLLTNVMIYWLTATAGSS
AHFYYEISDVLPTAPTPPPPAPPLPTPLGVAVYPADSAKPVRRFAERAFPNIVHWAELER
GGHFAALEQPGLFVSDLRAFARALRTS
selected fasta
>epoxide hydrolase [epoxide hydrolase]
ATGGAGCCGTTCCGTATAGTGATTCCGCAGGCAGATCTGGACGATCTGCACAGGCGCCTG
GATGCCACTCGGTGGCCGAGCGAGATCCCCGGGACGGGCTGGAGCCGCGGCGTCCCGTTG
GACTACCTCAAGGAACTGGTCGGTTACTGGCGCGACGGCTACGACTGGCGCGCGGCCGAG
GACCGCCTCAACACGGTCCCCCAGTTCACCACCGAGATCGACGGTACGAATGTGCACTTC
ATGCATATCCGCTCCGCCGAACCCGACGCTCTCCCGATGATCATCACCCATGGCTGGCCG
GGTTCGGTCGCCGAGTTCCTCGATGTCATCGATCCCCTGACCAATCCGCGGGCCCACGGG
GGCGATCCGGCCGACGCATTCCACTTGGTGATTCCATCCCTGCCCGGATTCGGCTTTTCC
GGGCCTACTCCGGAACCCGGCTGGAACCTGCCCCGGGTGGCTTCCGCGTGGGCGGAATTG
ATGCGACGCCTCGGATACTCCCGGTACGCTGTCCAGGGCGGCGATCTGGGTGCCTGGACC
AGCCTGACGCTCTCCGGCGTCGACCACGAGCACGTCGTGGGAACGCATGTGAACTTCCTG
ATCACTCCTCCCTCGGGTGACCCGGCGGACCTCGCCGGACTCGGTGAACAGGACCTCGCG
CGCCTGCAGCTGCTGGCCGAGTTCGGCGCGGAGGGCTCCGGGTACATGAAGATCCAGTCG
ACGCGACCCCAGACCCTCTCCTACAGCCTGACTGACTCGCCGGTGGGGCAGCTGGCCTGG
GTGGTCGAGAAGTTCATGGAATGGGGCGACACGGACAAGTCGCCCGAGGACGCCGTGGAC
CGTGACCGGCTGCTGACCAACGTCATGATCTACTGGCTCACCGCGACCGCCGGTTCGAGC
GCCCACTTCTACTACGAGATCTCCGACGTGCTGCCGACGGCTCCCACGCCGCCCCCTCCT
GCGCCACCGCTGCCGACGCCGCTGGGCGTCGCGGTGTACCCGGCCGATTCGGCGAAGCCC
GTGCGCCGGTTCGCGGAGCGCGCCTTCCCCAACATCGTGCACTGGGCGGAGCTCGAGCGC
GGCGGTCACTTCGCCGCCCTGGAGCAGCCCGGTCTGTTCGTCTCCGACCTGCGGGCGTTC
GCCCGCGCGCTGCGGACGTCCTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000639 Epoxide hydrolase-like (Family)
 [97-115]  5.29999657550189e-09 PR00412 [126-141]  5.29999657550189e-09 PR00412 [358-380]  5.29999657550189e-09 PR00412
PR00412   EPOXHYDRLASE
IPR010497 Epoxide hydrolase, N-terminal (Domain)
 [2-110]  1.5e-41 PF06441
PF06441   EHN
IPR016292 Epoxide hydrolase (Family)
 [1-387]  9.40003071030835e-106 PIRSF001112
PIRSF001112   Epoxide_hydrolase
SignalP No significant hit
TMHMM No significant hit