close all open/close all

CDS information : Ncarz_00260


close this sectionLocation

Organism
StrainATCC 15944
Entry nameNeocarzinostatin
Contig
Start / Stop / Direction47,373 / 45,715 / - [in whole cluster]
47,373 / 45,715 / - [in contig]
Locationcomplement(45715..47373) [in whole cluster]
complement(45715..47373) [in contig]
TypeCDS
Length1,659 bp (552 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)oxidoreductase
GenencsE9
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15797213] The neocarzinostatin biosynthetic gene cluster from Streptomyces carzinostaticus ATCC 15944 involving two iterative type I polyketide synthases. (Chem Biol. , 2005)
Related Reference
ACC
P12676
PmId
[2914858] Nucleotide sequence of the gene for cholesterol oxidase from a Streptomyces sp. (J Bacteriol. , 1989)
[10194345] Crystal structure determination of cholesterol oxidase from Streptomyces and structural characterization of key active site mutants. (Biochemistry. , 1999)
Family/Domain
FD
IPR007867, IPR000172

close this sectionSequence

selected fasta
>putative oxidoreductase [oxidoreductase]
MSGGAERTEVLVVGSGFGGAISAYHLAAGGAKVTVLERGPWLEHGQFEHDYKLGSSYTRI
FDFVVGDGMSVLGGNCVGGGSVVYFAAMPRAPRFVFDRKGSIGRRMWPKSISRNTLDPWY
DRVEESLSVARQGWQDVSYAGGLWAAACSHAGRTANPLPVAIDTVKCVNCNWMMAGCRFE
AKQSLLVNYLPAALAHGAEIRPLHEVQYLERTADGGYRVHYNVIDGEDYRTTAGSGVIEA
KIVVLAAGAGATPVILQRSEGQLGRMPHAVGRYFSGNGERLNTAVVDEDKAAELLGLDRG
SGPAYGANHIGRGPTVASWDRLDGSLPEYSRYSLEQLYFPPGLGTILAQVPHGTGPTWFG
ARKKEILKRWTSWLTVFSMIEDDNEGVFGPPPATGNAHRISQQLLGRGNLRYAPTQNTLN
AWAASDAEVKEILEKDGLAQVMPWTNDLVGAYTVHPLASCRMGDDPHTSALDDRNELRGH
PGIFVTDGSAVPGALTVNPALTISALAERAVPGIVEAAQDRGIRVSYGAPAPSGSVSGLR
QVLPLLPRPVGT
selected fasta
>putative oxidoreductase [oxidoreductase]
ATGAGCGGCGGCGCGGAGCGCACGGAGGTCCTGGTCGTCGGCAGCGGGTTCGGCGGCGCG
ATCAGCGCCTACCACCTCGCAGCCGGGGGCGCGAAGGTGACCGTACTGGAGCGCGGTCCC
TGGCTGGAACACGGCCAGTTCGAGCACGACTACAAGCTCGGCTCCTCCTACACGAGGATC
TTCGACTTCGTGGTCGGCGACGGGATGAGCGTGCTGGGCGGGAACTGTGTTGGCGGGGGC
AGCGTGGTCTACTTCGCCGCCATGCCGCGCGCACCGCGCTTCGTCTTCGACCGGAAGGGC
TCCATCGGCCGGCGCATGTGGCCGAAGTCGATCAGTCGCAACACCCTTGACCCTTGGTAC
GACCGTGTCGAGGAGTCACTGTCGGTCGCCCGGCAGGGCTGGCAGGACGTGAGCTACGCC
GGCGGCCTGTGGGCTGCAGCATGCTCCCACGCGGGCCGCACGGCCAACCCTCTCCCGGTG
GCCATCGACACCGTCAAGTGTGTCAACTGCAACTGGATGATGGCCGGGTGCCGCTTCGAG
GCCAAGCAGTCGCTGCTCGTGAACTACCTCCCCGCAGCCCTCGCCCATGGCGCCGAGATC
CGTCCCCTGCACGAGGTCCAGTACCTGGAGCGGACCGCGGACGGCGGGTACCGCGTGCAC
TACAACGTCATCGACGGCGAGGACTACCGCACGACCGCCGGCAGTGGGGTGATCGAGGCG
AAGATCGTCGTGTTGGCGGCCGGTGCCGGGGCGACGCCGGTGATCCTGCAGCGCAGCGAA
GGACAGCTCGGCCGGATGCCCCATGCGGTGGGACGCTACTTCTCGGGCAACGGCGAACGG
CTCAACACTGCCGTGGTGGACGAAGACAAGGCGGCCGAACTGCTCGGCCTGGACCGCGGG
AGCGGGCCAGCGTACGGCGCCAACCACATCGGCCGCGGACCGACCGTCGCGAGTTGGGAC
CGCCTGGACGGCTCCCTGCCCGAGTACTCCCGTTACTCGCTGGAGCAGCTCTACTTTCCA
CCCGGCCTGGGCACGATCCTCGCCCAAGTGCCGCACGGCACCGGCCCCACCTGGTTCGGC
GCCCGGAAGAAGGAGATCCTCAAACGGTGGACCTCCTGGCTGACGGTCTTCTCGATGATC
GAGGACGACAACGAGGGAGTTTTCGGCCCACCGCCAGCGACGGGCAACGCCCACCGTATC
TCGCAGCAGTTGCTCGGCCGCGGCAACCTCCGGTACGCGCCCACGCAGAACACGCTCAAC
GCCTGGGCCGCCTCCGACGCGGAGGTAAAGGAGATCCTTGAGAAGGACGGACTGGCCCAG
GTGATGCCTTGGACCAACGACCTGGTCGGCGCATACACCGTGCACCCCCTCGCCTCCTGC
CGGATGGGGGACGATCCGCACACGTCCGCTCTCGACGACCGCAACGAGCTGCGGGGGCAC
CCAGGGATCTTCGTCACGGACGGGTCCGCCGTTCCCGGTGCGCTGACCGTCAACCCGGCC
CTGACCATCTCGGCCCTCGCCGAACGGGCCGTGCCGGGCATCGTCGAGGCTGCGCAGGAC
CGTGGCATCCGCGTCAGCTACGGCGCGCCGGCGCCCAGCGGCTCCGTGAGCGGTCTGCGG
CAGGTCCTTCCGCTGCTGCCCCGCCCCGTGGGCACCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000172 Glucose-methanol-choline oxidoreductase, N-terminal (Domain)
 [10-259]  5.90000000000001e-15 PF00732
PF00732   GMC_oxred_N
IPR007867 Glucose-methanol-choline oxidoreductase, C-terminal (Domain)
 [445-510]  7.5e-16 PF05199
PF05199   GMC_oxred_C
SignalP
 [1-23]  0.16 Signal
Eukaryota   
TMHMM No significant hit