close all open/close all

CDS information : Ncarz_00270


close this sectionLocation

Organism
StrainATCC 15944
Entry nameNeocarzinostatin
Contig
Start / Stop / Direction47,969 / 47,370 / - [in whole cluster]
47,969 / 47,370 / - [in contig]
Locationcomplement(47370..47969) [in whole cluster]
complement(47370..47969) [in contig]
TypeCDS
Length600 bp (199 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)unknown
GenencsE8
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15797213] The neocarzinostatin biosynthetic gene cluster from Streptomyces carzinostaticus ATCC 15944 involving two iterative type I polyketide synthases. (Chem Biol. , 2005)

close this sectionSequence

selected fasta
>hypothetical protein [unknown]
MQKQKAERDDGSERRVRITDDAVLTLEAYADSIVPGEKRWPGDRAVAGASEGGGAVTAGA
IRLLRWDATGIHDDLENLADLANGHARTYAEETGLELDRSVPPFVALSYEDRVELIRRLT
APGHPEKEFWVLLSLFCNMAFDSAAHLHTAEAIADGHPGLQAMGITAPGDDGLWRFEDFG
YGRELARLHPETTSTGSPA
selected fasta
>hypothetical protein [unknown]
GTGCAGAAACAGAAAGCGGAACGAGATGACGGATCGGAGCGCAGAGTCCGAATCACGGAC
GATGCCGTGCTGACGCTCGAGGCCTACGCGGACTCGATCGTCCCCGGCGAGAAGCGCTGG
CCGGGAGACAGAGCCGTGGCCGGCGCCTCGGAGGGCGGCGGCGCCGTCACGGCAGGTGCC
ATCCGGCTCCTGCGCTGGGACGCCACTGGCATCCACGACGACCTCGAGAACCTGGCAGAC
CTTGCGAACGGCCATGCCCGCACGTATGCCGAGGAGACAGGGCTTGAGCTGGACAGGTCC
GTGCCGCCCTTCGTGGCCCTGTCCTACGAAGACCGAGTGGAGCTGATCCGCCGGCTCACC
GCTCCGGGGCACCCGGAGAAGGAGTTCTGGGTCCTTCTGTCCCTCTTCTGCAACATGGCT
TTCGACTCGGCTGCACACCTTCACACCGCAGAGGCGATCGCCGACGGTCATCCGGGCCTG
CAGGCCATGGGCATCACCGCTCCCGGTGACGACGGCTTGTGGCGCTTCGAGGACTTCGGC
TACGGCCGTGAGCTGGCGCGCCTCCATCCCGAAACCACCTCCACCGGGAGTCCGGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM No significant hit