close all open/close all

CDS information : Ncarz_00280


close this sectionLocation

Organism
StrainATCC 15944
Entry nameNeocarzinostatin
Contig
Start / Stop / Direction48,237 / 49,301 / + [in whole cluster]
48,237 / 49,301 / + [in contig]
Location48237..49301 [in whole cluster]
48237..49301 [in contig]
TypeCDS
Length1,065 bp (354 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative transcriptional regulator
Product (GenBank)transcriptional regulator
GenencsR6
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15797213] The neocarzinostatin biosynthetic gene cluster from Streptomyces carzinostaticus ATCC 15944 involving two iterative type I polyketide synthases. (Chem Biol. , 2005)
Related Reference
ACC
Q8GME5
NITE
C1027_00480
PmId
[19159491] Role of sgcR3 in positive regulation of enediyne antibiotic C-1027 production of Streptomyces globisporus C-1027. (BMC Microbiol. , 2009)
[20551990] Manipulation of pathway regulation in Streptomyces globisporus for overproduction of the enediyne antitumor antibiotic C-1027. (J Antibiot (Tokyo). , 2010)
[21250756] Improvement of the enediyne antitumor antibiotic C-1027 production by manipulating its biosynthetic pathway regulation in Streptomyces globisporus. (J Nat Prod. , 2011)

close this sectionSequence

selected fasta
>putative transcriptional regulator [transcriptional regulator]
MKNTEGTPEPLTDLTDWVKVDTLLPADSPRLNGLDEQHVKQLADVYPTLPPILVHSRTMR
VIDGMHRLAAARRNRLDFVAVRYFTGTEEESFLRSVSANVAHGLPLSPDERKTAAHRILD
MCPELSDRAVGACTGLSPKTVASVRSRSTEDSTRLNVRVRSNGKAHPLDRTAERLHAAQL
MIAQPDLPLRAVVKETGLSLGTVHDVRQRLLRGDAPVPASRRRPPRVQPSGTDLPASRRS
CGPEGPDPLHRAPETVPGRSRTSLEMLRKLASDPALRHSESGRHFLRWLHDHFVVDDSWR
QWAEAVPPHSAATLADLALHCSRTWKRFAEELTSRRLTGVQLSEELRADSKRRI
selected fasta
>putative transcriptional regulator [transcriptional regulator]
TTGAAAAACACTGAAGGGACCCCGGAACCATTGACGGACCTCACCGACTGGGTGAAGGTG
GATACGTTGCTGCCGGCGGATTCTCCGCGGCTGAATGGCCTTGATGAGCAGCACGTCAAA
CAACTGGCAGACGTCTATCCGACGCTGCCTCCGATTCTCGTGCACAGCAGAACGATGCGC
GTGATCGACGGGATGCACCGACTGGCGGCCGCACGACGCAATCGTCTGGACTTCGTGGCG
GTGCGGTACTTCACGGGAACCGAGGAGGAGTCGTTCCTCCGCTCCGTATCGGCCAACGTC
GCACACGGCCTCCCGCTGTCACCCGACGAACGCAAGACGGCGGCACACCGCATCCTGGAC
ATGTGTCCGGAACTCTCGGACCGGGCCGTCGGCGCGTGCACGGGCCTGTCGCCCAAGACG
GTAGCCTCGGTCCGGTCGCGTTCAACTGAGGATTCCACCCGGTTGAACGTCCGGGTCAGG
AGCAACGGCAAAGCCCATCCGCTCGACCGCACTGCCGAGCGTCTGCACGCGGCCCAGCTG
ATGATCGCCCAGCCCGACCTCCCGCTGCGGGCGGTCGTCAAGGAGACCGGGCTCTCGCTG
GGGACGGTGCACGACGTCCGCCAGCGCCTGCTGCGCGGGGACGCACCCGTGCCCGCCAGC
CGCCGGCGGCCACCTCGCGTCCAGCCCTCGGGCACCGACCTCCCCGCATCCCGGCGCAGC
TGCGGTCCGGAAGGCCCAGACCCGCTCCACCGCGCGCCCGAAACGGTCCCAGGGCGGTCA
CGCACATCCCTGGAAATGCTGCGCAAACTCGCTTCCGACCCGGCGCTGCGACACTCGGAA
TCCGGCCGGCACTTCTTGCGCTGGCTCCACGACCACTTCGTTGTGGACGATTCCTGGCGC
CAATGGGCGGAAGCTGTTCCACCTCACTCAGCTGCCACACTGGCGGATCTCGCTCTCCAC
TGCTCACGCACGTGGAAAAGGTTCGCCGAAGAGCTCACCAGTCGTCGACTGACCGGCGTC
CAGCTCTCCGAAGAGTTGCGAGCGGACTCGAAGCGACGGATTTAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003115 ParB-like nuclease (Domain)
 [15-102]  4.99999811956429e-09 SSF110849
SSF110849   ParBc
 [16-100]  1.09999909120787e-09 SM00470
SM00470   ParB
 [17-99]  6.50000000000001e-09 PF02195
PF02195   ParBc
SignalP No significant hit
TMHMM No significant hit