close all open/close all

CDS information : Ncarz_00290


close this sectionLocation

Organism
StrainATCC 15944
Entry nameNeocarzinostatin
Contig
Start / Stop / Direction49,345 / 50,139 / + [in whole cluster]
49,345 / 50,139 / + [in contig]
Location49345..50139 [in whole cluster]
49345..50139 [in contig]
TypeCDS
Length795 bp (264 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative AraC family transcriptional regulator
Product (GenBank)transcriptional regulator
GenencsR5
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15797213] The neocarzinostatin biosynthetic gene cluster from Streptomyces carzinostaticus ATCC 15944 involving two iterative type I polyketide synthases. (Chem Biol. , 2005)
Related Reference
ACC
Q8GME4
NITE
C1027_00490
PmId
[19159491] Role of sgcR3 in positive regulation of enediyne antibiotic C-1027 production of Streptomyces globisporus C-1027. (BMC Microbiol. , 2009)
[20551990] Manipulation of pathway regulation in Streptomyces globisporus for overproduction of the enediyne antitumor antibiotic C-1027. (J Antibiot (Tokyo). , 2010)

close this sectionSequence

selected fasta
>putative AraC family transcriptional regulator [transcriptional regulator]
MTSATIEHAVHRVISNMRANLGQDLTIDDMARTAMFSKFHFTRIFRDVTGTSPGRFLSAL
RIQEAKRLLVQTQFSVADISSLVGYSSVGTFSSRFKACVGVSPSVYRELEGFATGIDQEP
WPDSPTSPAGVSGITLWGHVTLPEGRAPGPCYVGLFPTQVPQGRPVRCSVLEGPGPFELR
NVPVGTWYLLVHSVPYGQEHLVSGAAGDEDSDTVSVGRHGPLTVRAETVPLPVSVALRPL
EVFDPPVLMALLDLRTGTLASATG
selected fasta
>putative AraC family transcriptional regulator [transcriptional regulator]
ATGACTTCCGCTACCATCGAGCACGCAGTTCACCGGGTCATCAGCAATATGCGGGCCAAT
CTCGGGCAAGACCTGACGATCGACGACATGGCACGCACCGCTATGTTCAGTAAATTCCAC
TTCACTCGTATATTCAGGGACGTGACCGGCACCTCGCCCGGCAGGTTCCTTTCGGCTCTG
CGCATCCAGGAGGCCAAGCGCCTGCTCGTGCAGACGCAGTTCAGCGTCGCGGACATCAGC
AGCCTGGTCGGCTACAGCAGCGTCGGCACCTTCAGCTCGCGCTTCAAGGCATGTGTGGGC
GTCTCCCCGAGCGTCTACCGCGAACTGGAGGGCTTCGCCACCGGCATCGACCAGGAACCG
TGGCCGGACTCCCCCACCTCCCCGGCCGGCGTCTCCGGCATCACTCTGTGGGGCCACGTC
ACGCTTCCCGAGGGGCGTGCCCCAGGCCCTTGTTACGTCGGCCTGTTTCCCACCCAGGTT
CCTCAGGGGCGGCCGGTGAGATGCTCCGTCCTGGAGGGACCCGGCCCCTTCGAACTGCGC
AACGTTCCCGTCGGCACCTGGTACCTCCTGGTGCACTCGGTGCCCTACGGCCAGGAGCAC
CTCGTCTCCGGCGCCGCCGGTGACGAAGACAGCGACACCGTTTCCGTCGGACGCCACGGC
CCGCTGACGGTGCGGGCCGAGACAGTGCCCCTGCCGGTCAGTGTCGCGCTGCGACCGCTG
GAGGTCTTCGACCCGCCGGTGCTGATGGCACTGCTCGACCTGCGCACCGGCACCCTGGCG
AGCGCCACGGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009057 Homeodomain-like (Domain)
 [6-57]  1.29999924468179e-10 SSF46689 [60-108]  3.1999989904635e-13 SSF46689
SSF46689   Homeodomain_like
 [8-60]  1.3e-22 G3DSA:1.10.10.60 [61-108]  6.1e-20 G3DSA:1.10.10.60
G3DSA:1.10.10.60   Homeodomain-rel
IPR018060 DNA binding HTH domain, AraC-type (Domain)
 [24-107]  3.89999861795218e-33 SM00342
SM00342   HTH_ARAC
 [11-109]  PS01124
PS01124   HTH_ARAC_FAMILY_2
IPR018062 HTH domain AraC-type, conserved site (Conserved_site)
 [61-103]  PS00041
PS00041   HTH_ARAC_FAMILY_1
IPR020449 Transcription regulator HTH, AraC- type (Family)
 [76-91]  3.30000164480624e-05 PR00032 [91-107]  3.30000164480624e-05 PR00032
PR00032   HTHARAC
SignalP No significant hit
TMHMM No significant hit