close all open/close all

CDS information : Ncarz_00300


close this sectionLocation

Organism
StrainATCC 15944
Entry nameNeocarzinostatin
Contig
Start / Stop / Direction51,551 / 50,199 / - [in whole cluster]
51,551 / 50,199 / - [in contig]
Locationcomplement(50199..51551) [in whole cluster]
complement(50199..51551) [in contig]
TypeCDS
Length1,353 bp (450 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative cytochrome P450
Product (GenBank)cytochrome P-450
GenencsE7
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15797213] The neocarzinostatin biosynthetic gene cluster from Streptomyces carzinostaticus ATCC 15944 involving two iterative type I polyketide synthases. (Chem Biol. , 2005)
Related Reference
ACC
C9K1X7
PmId
[19635410] Cloning and heterologous expression of the cyclooctatin biosynthetic gene cluster afford a diterpene cyclase and two p450 hydroxylases. (Chem Biol. , 2009)
ACC
P15129
PmId
[2229008] Purification and characterization of rat pulmonary cytochrome P-450. (J Biochem. , 1990)

close this sectionSequence

selected fasta
>putative cytochrome P450 [cytochrome P-450]
MNGRRPVSPPLRALPGLLRKLAVDRLGMMRDAAALDDAVLVSMGPKKLFVFNRPDYAKHV
LADNAANYRKGIGLIESRKMLGDGLLTSEGELWREQRRTVQPAFRPARVAAQADAVAEET
MNLRDLLMRRGADGPVDVLQEVTGFTLGVLGRTVLNTDLGGYGGIAHAFEAVQDQAMFDM
VTQNMVPTWAPLATQRRFRRARRELIRTVDELVADRSARMTDGEEADDAFSLMIAAARRQ
TDPRTGQGRLRDELVTLLLAGHETTASTLAWTLLLLARHPHMRDLVREEARGVLADGRAP
DAGDLRKLTYTTQVVQEAMRLYPPVWILPRVARQSDEVGPYSVSAGADVLICPYTLHRHP
DLWERPEQFDPGRFDPARVADRPRYAYIPFGAGPRFCVGSNLGMMEAVFVTALLTRDLVL
EVVPGDERTPEPMMSLRMRGGLPMTVRPVR
selected fasta
>putative cytochrome P450 [cytochrome P-450]
ATGAATGGGCGGCGTCCGGTCTCCCCTCCGCTGCGGGCGCTACCCGGCCTGTTGCGCAAG
CTCGCCGTCGACCGGCTCGGGATGATGCGTGACGCGGCGGCGCTGGACGATGCTGTGCTG
GTCTCCATGGGGCCGAAGAAGCTGTTCGTCTTCAACCGGCCCGACTACGCGAAGCACGTG
CTGGCGGACAACGCCGCCAACTATCGAAAGGGCATCGGTCTGATCGAGTCCCGGAAGATG
CTCGGCGACGGTCTCCTGACGAGCGAGGGTGAACTGTGGCGCGAGCAGCGGCGCACGGTG
CAGCCAGCGTTCAGGCCGGCGCGCGTGGCCGCTCAGGCCGACGCGGTGGCGGAAGAGACC
ATGAACCTTCGGGACCTGCTGATGCGACGGGGCGCCGACGGACCCGTCGACGTACTCCAG
GAGGTGACTGGGTTCACGCTCGGTGTGCTGGGCCGGACCGTGCTCAACACCGACCTCGGG
GGGTACGGGGGCATCGCCCACGCCTTCGAAGCGGTACAGGACCAGGCGATGTTCGACATG
GTCACCCAGAACATGGTGCCGACGTGGGCTCCGCTGGCCACTCAGCGGCGGTTCCGAAGA
GCCCGCCGGGAACTCATACGGACCGTTGATGAACTGGTGGCCGACCGCAGCGCTCGCATG
ACCGACGGAGAGGAGGCCGACGACGCGTTCTCTCTCATGATTGCGGCTGCTCGCCGGCAG
ACCGATCCGAGGACCGGGCAGGGGCGGCTGCGCGACGAACTGGTGACGCTGCTCCTCGCC
GGGCACGAGACTACGGCGAGCACACTGGCGTGGACCTTGCTACTGCTTGCCCGTCATCCG
CACATGAGGGATCTGGTGCGCGAGGAGGCCCGCGGAGTGCTTGCGGACGGCCGGGCCCCG
GACGCCGGGGACCTGCGCAAACTGACTTACACGACGCAGGTCGTCCAGGAGGCCATGCGT
CTGTATCCGCCGGTGTGGATTTTGCCTCGGGTGGCCCGGCAGTCCGACGAGGTGGGACCG
TACTCGGTGTCGGCCGGCGCCGACGTCCTGATCTGCCCGTACACCCTGCACCGTCATCCG
GATCTGTGGGAGCGGCCGGAACAGTTCGACCCAGGGCGGTTCGACCCGGCGCGCGTCGCC
GATCGCCCTCGCTACGCCTACATCCCATTCGGCGCCGGTCCCCGCTTCTGTGTCGGCAGC
AACCTGGGGATGATGGAGGCGGTCTTCGTTACCGCCCTCCTGACACGGGATCTCGTCCTG
GAGGTCGTGCCCGGCGATGAGAGGACGCCCGAGCCGATGATGTCCCTGCGCATGCGGGGC
GGGCTTCCCATGACGGTTCGGCCTGTGCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [3-448]  3.10001307370203e-106 SSF48264
SSF48264   Cytochrome_P450
 [260-277]  4.19999771339581e-15 PR00385 [313-324]  4.19999771339581e-15 PR00385 [388-397]  4.19999771339581e-15 PR00385 [397-408]  4.19999771339581e-15 PR00385
PR00385   P450
 [37-432]  1.79999999999997e-76 PF00067
PF00067   p450
 [8-448]  5.40000000000002e-106 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
IPR002401 Cytochrome P450, E-class, group I (Family)
 [249-266]  2.60000517657733e-18 PR00463 [269-295]  2.60000517657733e-18 PR00463 [352-376]  2.60000517657733e-18 PR00463 [387-397]  2.60000517657733e-18 PR00463 [397-420]  2.60000517657733e-18 PR00463
PR00463   EP450I
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [390-399]  PS00086
PS00086   CYTOCHROME_P450
SignalP
 [1-13]  0.48 Signal
Bacteria, Gram-negative   
TMHMM No significant hit