close all open/close all

CDS information : Ncarz_00310


close this sectionLocation

Organism
StrainATCC 15944
Entry nameNeocarzinostatin
Contig
Start / Stop / Direction52,096 / 51,548 / - [in whole cluster]
52,096 / 51,548 / - [in contig]
Locationcomplement(51548..52096) [in whole cluster]
complement(51548..52096) [in contig]
TypeCDS
Length549 bp (182 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative flavin reductase
Product (GenBank)monooxygenase
GenencsE6
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15797213] The neocarzinostatin biosynthetic gene cluster from Streptomyces carzinostaticus ATCC 15944 involving two iterative type I polyketide synthases. (Chem Biol. , 2005)
Related Reference
ACC
Q8GME2
NITE
C1027_00510
PmId
[19817865] Characterization of SgcE6, the flavin reductase component supporting FAD-dependent halogenation and hydroxylation in the biosynthesis of the enediyne antitumor antibiotic C-1027. (FEMS Microbiol Lett. , 2009)

close this sectionSequence

selected fasta
>putative flavin reductase [monooxygenase]
MRTLAAEFSPHPGEAADPERLRSALGTFATGVTVVTVGGSSPHGMTANSFTSVSLDPALV
LVCLGRDTVMHRVLAEADTFSVSVLDAGQEEVARHFADRSRPRGPAQFETVGWVPGRSAD
APLIAGAAAHFECAKWRAYEGGDHTICVGRVLTLRESPDREPLLFHRGRFRRLPDGRQEG
AA
selected fasta
>putative flavin reductase [monooxygenase]
ATGAGGACACTCGCCGCCGAGTTCTCCCCGCACCCGGGGGAAGCGGCCGATCCGGAGCGG
CTGCGTAGCGCGCTGGGGACGTTCGCCACCGGCGTGACCGTGGTGACGGTCGGTGGCTCC
TCACCCCACGGCATGACGGCCAATTCCTTCACCTCCGTCTCCCTGGACCCAGCCCTGGTG
CTGGTGTGTCTGGGCCGGGACACGGTGATGCACCGTGTCCTGGCCGAGGCCGACACCTTC
TCTGTGTCCGTGCTGGACGCCGGGCAGGAGGAGGTGGCCCGACACTTCGCCGACCGCTCC
CGGCCGAGGGGCCCGGCCCAGTTCGAGACCGTCGGCTGGGTGCCGGGCCGGTCGGCAGAC
GCACCACTGATCGCTGGCGCCGCCGCACATTTCGAGTGCGCGAAGTGGCGTGCCTACGAG
GGTGGGGACCACACCATATGCGTGGGGAGGGTGCTCACCCTGAGGGAGTCTCCCGACCGG
GAGCCGCTGCTGTTCCACCGAGGCCGGTTCCGTCGCTTGCCCGACGGGCGACAGGAGGGT
GCGGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002563 Flavin reductase-like, FMN-binding (Domain)
 [25-172]  9.40003071030835e-58 SM00903
SM00903   Flavin_Reduct
 [26-173]  2.59999999999998e-38 PF01613
PF01613   Flavin_Reduct
IPR009002 FMN-binding split barrel-related (Domain)
 [13-181]  1.70000295590053e-50 SSF50475
SSF50475   FMN_binding
IPR012349 FMN-binding split barrel (Domain)
 [16-175]  3.5e-57 G3DSA:2.30.110.10
G3DSA:2.30.110.10   PNPOx_FMN_bd
SignalP
 [1-15]  0.112 Signal
Eukaryota   
 [1-5]  0.28 Signal
Bacteria, Gram-negative   
TMHMM No significant hit