close all open/close all

CDS information : Ncarz_00340


close this sectionLocation

Organism
StrainATCC 15944
Entry nameNeocarzinostatin
Contig
Start / Stop / Direction59,568 / 58,474 / - [in whole cluster]
59,568 / 58,474 / - [in contig]
Locationcomplement(58474..59568) [in whole cluster]
complement(58474..59568) [in contig]
TypeCDS
Length1,095 bp (364 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.3 uncharacterized protein (biosynthesis involved)
Producthypothetical protein
Product (GenBank)putative transporter
GenencsE5
unbU
Gene (GenBank)
EC number
Keyword
  • enediyne core
Note
Note (GenBank)
Reference
ACC
PmId
[15797213] The neocarzinostatin biosynthetic gene cluster from Streptomyces carzinostaticus ATCC 15944 involving two iterative type I polyketide synthases. (Chem Biol. , 2005)
[12536216] A genomics-guided approach for discovering and expressing cryptic metabolic pathways. (Nat Biotechnol. , 2003)

close this sectionSequence

selected fasta
>hypothetical protein [putative transporter]
MTMSAAQPLSQTAGPRHNPKVVTALRRFAISISVLNIVGYTVLGFEQPWLWPFIALATAY
TVELTLEAVGARAEKRATRFRGGGFRGLMEFLYPAHITALAVNMLTYVNDQVWVMVFGVV
VAVGAKWVLRAPVRGRMRHFMNPSNLGIAVILLLFPWASIAPPYHFTEYVDGGIDWLVPA
VILTLGTMLNAKLTERMWLIVAWVGGFAAQAVVRGLLFGTSIPAALAMMTGVAFVLFTNY
MITDPGTTPSSKWGQIAFGGGVAAAYGLLTALSVAYGIFFATALVCGVRGGFLWISDIVS
RRRTEEALAVAAVGLTSEKPSVERTPIEHAETLPCVNGCAEGACSCSGNPKDSEADDRRI
VVSA
selected fasta
>hypothetical protein [putative transporter]
GTGACCATGTCCGCAGCACAGCCCCTGTCCCAGACCGCGGGACCGCGCCACAACCCGAAG
GTCGTCACCGCCCTCCGCCGCTTCGCGATCTCGATCTCCGTACTCAACATCGTCGGCTAC
ACCGTACTGGGCTTCGAACAGCCCTGGCTCTGGCCCTTCATCGCGCTGGCGACGGCCTAC
ACCGTGGAGCTCACGCTCGAGGCCGTCGGTGCACGCGCCGAGAAGCGAGCGACTCGCTTC
CGCGGGGGCGGCTTCCGAGGGCTGATGGAATTCCTCTACCCCGCACACATCACGGCCCTC
GCGGTGAACATGCTCACCTACGTCAACGACCAGGTGTGGGTCATGGTGTTCGGCGTCGTG
GTGGCGGTAGGCGCCAAGTGGGTGCTGCGGGCCCCGGTGAGGGGCCGCATGCGCCACTTC
ATGAACCCCTCGAATCTCGGCATCGCGGTCATCCTGCTGTTGTTCCCGTGGGCGTCGATC
GCCCCGCCGTACCACTTCACCGAGTACGTGGACGGCGGCATTGACTGGCTCGTGCCGGCC
GTCATCCTCACGCTCGGCACCATGCTCAACGCGAAGCTCACCGAACGCATGTGGCTCATC
GTCGCGTGGGTCGGCGGGTTCGCCGCGCAGGCGGTCGTGCGAGGGCTGTTGTTCGGCACG
TCGATTCCTGCGGCCCTCGCGATGATGACCGGTGTGGCGTTCGTACTCTTCACGAACTAC
ATGATCACGGACCCCGGCACCACGCCGTCCTCCAAGTGGGGCCAGATCGCCTTCGGGGGC
GGTGTCGCCGCCGCGTACGGCCTCCTGACGGCGCTGAGTGTCGCCTACGGGATCTTCTTC
GCCACCGCTCTGGTCTGCGGGGTCCGCGGTGGCTTCCTGTGGATCAGCGACATCGTCTCC
CGCAGGCGCACCGAGGAGGCCCTGGCCGTTGCCGCGGTCGGCCTGACCTCCGAGAAGCCC
TCCGTCGAGCGCACCCCGATCGAGCACGCGGAAACACTCCCGTGCGTGAACGGCTGCGCC
GAAGGGGCCTGCTCCTGCTCCGGGAACCCGAAGGACAGCGAGGCGGACGACCGCAGGATC
GTGGTGTCGGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM
 [28-45]  Transmembrane (i-o) [49-71]  Transmembrane (o-i) [91-108]  Transmembrane (i-o) [112-129]  Transmembrane (o-i) [142-161]  Transmembrane (i-o) [176-194]  Transmembrane (o-i) [215-237]  Transmembrane (i-o) [257-279]  Transmembrane (o-i)
Transmembrane 8