close all open/close all

CDS information : Ncarz_00350


close this sectionLocation

Organism
StrainATCC 15944
Entry nameNeocarzinostatin
Contig
Start / Stop / Direction61,475 / 59,565 / - [in whole cluster]
61,475 / 59,565 / - [in contig]
Locationcomplement(59565..61475) [in whole cluster]
complement(59565..61475) [in contig]
TypeCDS
Length1,911 bp (636 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.3 uncharacterized protein (biosynthesis involved)
Producthypothetical protein
Product (GenBank)unknown
GenencsE4
unbV
Gene (GenBank)
EC number
Keyword
  • enediyne core
Note
Note (GenBank)
Reference
ACC
PmId
[15797213] The neocarzinostatin biosynthetic gene cluster from Streptomyces carzinostaticus ATCC 15944 involving two iterative type I polyketide synthases. (Chem Biol. , 2005)
[12536216] A genomics-guided approach for discovering and expressing cryptic metabolic pathways. (Nat Biotechnol. , 2003)
Related Reference
ACC
Q84HJ0
NITE
Dynm_00160
PmId
[18328078] The biosynthetic genes encoding for the production of the dynemicin enediyne core in Micromonospora chersina ATCC53710. (FEMS Microbiol Lett. , 2008)

close this sectionSequence

selected fasta
>hypothetical protein [unknown]
MTMAKNWLRRNSPGIVALTLMASVFYVVRLPEPSAADVRESAADFAFEPMTIAMPGGFPT
QKIRQVNKAYEHIDAWISSVGAGIALNDMDGDGLSNDLCLTDPRIDQAVVTPAPSRGKAY
EPFALDAAPLGISDTMAPMGCVPGDFNEDGAIDLLVYYWGRTPVIFQNEGGRGEPLTASS
FTPTELLPGKPGPRYTGPLWNSNTAAVADFDGDGHDDIYIGNYFPDSPVLDPSKNGDVTM
NDSLSHAQNGGGGHFFRWTESGFEKTDDAIPQGLNKGWSLGASAADLDGDRLPEIFLAHD
FGTSALLHNTSRPGRIEFREVKAVHSGTVPKSKEIGRSSFKGMGVDFGDLDHDGLYDMFV
SNITTSFGIQESNFAFINKAGDKADLRSRFENGEAPYRDESTDLGLAWSGWGWDVKMGDF
DNNGDLEITQALGFVKGKNNRWPQLQELATSNDALVANPTWWPNVRQGDDLAGSQRMRFF
AKDQDTGRYINLSTALGLGDPVPTRGIATGDVDGDGRLDIAVARQWDEPVFYRNTAPEPG
SWLELVFTHPDGAPVVGAEVRVELPDGSKRVARVDGGGGHSGKRSTDIHIGLGEEAQGEV
SGTVTWRDREGDVHEQEVRLAPGRHSFELGSQVKEK
selected fasta
>hypothetical protein [unknown]
GTGACCATGGCGAAGAACTGGCTACGCAGGAATTCTCCGGGAATCGTCGCGCTCACCCTG
ATGGCGAGCGTCTTCTACGTCGTTCGCCTCCCTGAACCGTCTGCCGCCGATGTCAGGGAA
TCGGCAGCCGACTTCGCCTTCGAGCCGATGACCATAGCCATGCCGGGAGGATTTCCCACA
CAGAAGATCAGACAGGTCAACAAGGCTTACGAGCACATCGACGCCTGGATTTCATCGGTC
GGCGCCGGCATCGCCCTCAATGACATGGACGGCGACGGCCTGTCCAATGATCTGTGCCTG
ACCGACCCCAGGATCGACCAGGCCGTGGTGACCCCGGCTCCCTCGCGCGGCAAGGCCTAC
GAACCGTTCGCACTCGATGCGGCCCCCCTGGGAATCAGCGACACCATGGCTCCGATGGGG
TGCGTACCCGGTGACTTCAACGAGGACGGCGCCATCGACCTGCTCGTCTACTACTGGGGC
CGCACCCCTGTGATCTTCCAGAACGAAGGTGGCCGTGGCGAGCCACTCACCGCTTCCTCG
TTCACGCCCACGGAACTGCTACCGGGTAAACCCGGCCCGCGGTACACGGGTCCGCTGTGG
AACAGCAACACAGCCGCCGTCGCCGACTTCGACGGCGACGGACACGACGACATCTACATC
GGCAACTACTTCCCCGACAGCCCGGTCCTCGACCCGTCCAAGAACGGCGACGTCACCATG
AACGACTCGCTGTCGCACGCCCAGAACGGCGGTGGTGGTCACTTCTTCCGCTGGACCGAG
TCCGGTTTCGAGAAGACGGACGATGCCATACCGCAGGGCCTCAACAAGGGATGGTCACTC
GGCGCGTCGGCCGCGGACCTTGACGGCGACCGTCTTCCTGAGATCTTCCTCGCCCATGAC
TTCGGGACCTCGGCGCTGTTGCACAACACCTCGCGGCCGGGCCGGATCGAGTTCCGCGAG
GTCAAAGCGGTCCACTCCGGCACCGTTCCCAAGTCCAAGGAGATCGGACGCAGCTCCTTC
AAGGGGATGGGTGTCGACTTCGGTGACCTGGACCACGACGGCCTGTACGACATGTTCGTC
AGCAACATCACGACATCGTTCGGGATCCAGGAGTCGAACTTCGCCTTCATCAACAAGGCC
GGCGACAAGGCCGACCTGCGGTCCCGCTTCGAGAACGGCGAGGCGCCCTACAGGGACGAG
TCGACCGACCTCGGCCTGGCCTGGTCCGGCTGGGGCTGGGACGTGAAGATGGGCGATTTC
GACAACAACGGCGATCTTGAGATCACCCAGGCGCTCGGTTTCGTCAAGGGCAAGAACAAC
CGCTGGCCGCAGTTGCAGGAACTCGCCACGTCCAACGACGCGCTGGTCGCCAACCCCACC
TGGTGGCCGAACGTCAGGCAGGGAGATGACCTCGCCGGCAGCCAGCGGATGCGGTTCTTC
GCCAAGGACCAGGACACCGGCCGCTACATCAACCTCTCCACGGCGCTGGGCCTGGGGGAT
CCTGTTCCGACCCGTGGCATCGCGACCGGTGACGTGGACGGCGACGGCCGCCTCGACATC
GCAGTCGCCCGCCAGTGGGACGAGCCCGTCTTCTACCGCAACACGGCCCCCGAGCCCGGC
TCCTGGCTGGAACTCGTCTTCACGCACCCCGACGGTGCTCCGGTGGTCGGAGCCGAAGTC
CGCGTCGAGCTGCCCGACGGGAGCAAGAGGGTCGCCCGCGTCGACGGGGGCGGTGGCCAC
TCGGGCAAACGAAGTACCGATATCCACATCGGCCTGGGCGAGGAGGCCCAGGGCGAGGTC
TCAGGGACGGTCACCTGGCGCGACCGCGAAGGTGACGTCCACGAGCAGGAAGTGAGGCTG
GCGCCGGGCAGGCACAGCTTCGAGCTCGGCAGCCAGGTCAAGGAGAAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011519 ASPIC/UnbV (Domain)
 [554-626]  5.59999999999999e-17 PF07593
PF07593   UnbV_ASPIC
IPR013517 FG-GAP repeat (Repeat)
 [201-236]  1.2e-06 PF01839 [505-523]  1.5e-05 PF01839
PF01839   FG-GAP
SignalP
 [1-36]  0.542 Signal
Eukaryota   
 [1-36]  0.996 Signal
Bacteria, Gram-positive   
 [1-36]  0.482 Signal
Bacteria, Gram-negative   
TMHMM No significant hit