close all open/close all

CDS information : Ncarz_00380


close this sectionLocation

Organism
StrainATCC 15944
Entry nameNeocarzinostatin
Contig
Start / Stop / Direction64,068 / 63,625 / - [in whole cluster]
64,068 / 63,625 / - [in contig]
Locationcomplement(63625..64068) [in whole cluster]
complement(63625..64068) [in contig]
TypeCDS
Length444 bp (147 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative HxlR family transcriptional regulator
Product (GenBank)unknown
GenencsE1
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15797213] The neocarzinostatin biosynthetic gene cluster from Streptomyces carzinostaticus ATCC 15944 involving two iterative type I polyketide synthases. (Chem Biol. , 2005)
Related Reference
ACC
Q8GMD6
NITE
C1027_00570
PmId
[21250756] Improvement of the enediyne antitumor antibiotic C-1027 production by manipulating its biosynthetic pathway regulation in Streptomyces globisporus. (J Nat Prod. , 2011)
ACC
P42406
PmId
[10572115] Bacillus subtilis yckG and yckF encode two key enzymes of the ribulose monophosphate pathway used by methylotrophs, and yckH is required for their expression. (J Bacteriol. , 1999)
[15978081] HxlR, a member of the DUF24 protein family, is a DNA-binding protein that acts as a positive regulator of the formaldehyde-inducible hxlAB operon in Bacillus subtilis. (Mol Microbiol. , 2005)
Family/Domain
FD
IPR002577

close this sectionSequence

selected fasta
>putative HxlR family transcriptional regulator [unknown]
MLKHTYEGQDCSLARALEVIGERWTLLIVRSALLGVRRFEGFLGSMDIARNVLANRLVRL
VDAGLMERVPYQWKPLRHEYVLTSAGHDLTRSVIALIQWGDRNVPARLGPPRRAEHRGCD
GSVSVELHCSRCGHEVGDEEVTMRRLR
selected fasta
>putative HxlR family transcriptional regulator [unknown]
ATGCTGAAGCACACGTACGAGGGGCAGGACTGTAGCCTGGCCCGTGCCCTTGAAGTCATC
GGTGAACGCTGGACACTGCTCATCGTCCGTTCGGCGCTGCTCGGTGTCCGCCGCTTCGAA
GGCTTCCTTGGCAGCATGGACATCGCCCGCAACGTTCTGGCGAACCGGCTGGTGCGACTG
GTTGACGCAGGCCTCATGGAGCGAGTTCCCTACCAGTGGAAACCCCTTCGTCACGAGTAC
GTGCTGACTTCCGCCGGACATGACCTCACGCGGTCGGTCATAGCGCTCATCCAGTGGGGC
GACCGGAACGTGCCCGCGCGCCTGGGGCCCCCGCGCAGGGCCGAGCACCGCGGGTGCGAC
GGATCCGTCTCCGTCGAGCTGCACTGTTCGCGCTGCGGTCACGAAGTCGGTGACGAGGAA
GTGACGATGCGACGCCTGCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002577 Helix-turn-helix, HxlR type (Domain)
 [11-108]  PS51118
PS51118   HTH_HXLR
 [19-105]  1.9e-19 PF01638
PF01638   HxlR
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [10-99]  1.1e-06 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
SignalP No significant hit
TMHMM No significant hit