close all open/close all

CDS information : Ncarz_00390


close this sectionLocation

Organism
StrainATCC 15944
Entry nameNeocarzinostatin
Contig
Start / Stop / Direction64,364 / 65,566 / + [in whole cluster]
64,364 / 65,566 / + [in contig]
Location64364..65566 [in whole cluster]
64364..65566 [in contig]
TypeCDS
Length1,203 bp (400 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative transposase
Product (GenBank)transposase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15797213] The neocarzinostatin biosynthetic gene cluster from Streptomyces carzinostaticus ATCC 15944 involving two iterative type I polyketide synthases. (Chem Biol. , 2005)
Family/Domain
FD
IPR010095, IPR001959

close this sectionSequence

selected fasta
>putative transposase [transposase]
MWGGGHARYTYRLRVSSGARTALVAEWGRCRWVWNECVAKPRAVHQHNKATGEKATCGPA
LLDRMLTKARARTPWLREGSSVVQQQVIRDFGRSRAKAHQDLKDGLPLARRAGIPKWKTR
REALPSLNYTRRGFRLKDGRLHLAGGVVLTVVWSRDLPGEPSSVRVYQDSLGHWYGSFVV
PAQVEPLPATGRVLGVDWGVKETATTTSGAHDLPHAGHSGTARAKLTRYDRMTARRRPQK
GRPGSKGYREAKRLRAKAHKKVARQHADTGCKWAMKVVRDHDAIAVEDFRPKFLARTTMA
RKAADAAIGATKAALIEMGRKHGRDIRLVHPAHTTMDCAQCGARTKHALPLSERTYTCTA
CGTVCPRDKNSARVMLVRAGLNPAGADGRRPPGALLQEAA
selected fasta
>putative transposase [transposase]
ATGTGGGGGGGTGGGCATGCGCGGTACACATACCGGTTGCGTGTGTCGTCCGGTGCCCGC
ACGGCTCTGGTGGCGGAGTGGGGCCGGTGCCGCTGGGTGTGGAACGAGTGCGTCGCCAAG
CCCAGGGCCGTACACCAGCACAACAAGGCGACCGGCGAGAAGGCCACGTGCGGCCCGGCC
CTGCTGGACAGGATGCTGACCAAGGCCCGCGCCCGTACGCCGTGGCTGCGGGAGGGCTCT
TCGGTTGTGCAGCAGCAGGTCATCCGCGACTTCGGCCGCTCCCGCGCCAAGGCGCACCAG
GACCTCAAAGACGGCCTGCCCCTGGCGCGCCGGGCCGGGATACCGAAGTGGAAGACCCGA
CGCGAGGCGCTGCCGAGTCTCAACTACACCCGGCGTGGGTTCCGGCTGAAGGACGGCCGG
CTGCACCTGGCGGGCGGCGTCGTCCTGACGGTGGTGTGGTCGCGGGATCTGCCGGGTGAG
CCGTCCTCGGTGCGCGTGTACCAGGACAGTCTCGGGCACTGGTACGGCTCGTTCGTCGTC
CCCGCTCAGGTCGAGCCGCTGCCTGCGACCGGCCGCGTGCTCGGTGTCGACTGGGGCGTG
AAAGAGACGGCGACCACCACGTCCGGCGCGCACGATCTGCCGCATGCCGGGCACAGCGGG
ACGGCCCGGGCGAAGCTGACCCGGTACGACCGGATGACAGCCCGCCGCAGACCACAGAAG
GGGCGGCCCGGCTCGAAGGGCTACCGGGAGGCGAAGAGGCTGCGGGCGAAGGCCCACAAG
AAGGTCGCCAGGCAGCACGCGGACACCGGCTGCAAGTGGGCCATGAAGGTAGTCCGCGAC
CACGACGCCATCGCCGTCGAGGACTTCCGCCCGAAGTTCCTGGCCAGAACCACGATGGCC
CGCAAGGCCGCCGACGCCGCCATCGGCGCCACCAAGGCCGCTCTGATCGAGATGGGCCGC
AAACACGGCCGGGACATCCGCCTGGTCCACCCCGCGCACACCACCATGGACTGCGCACAG
TGCGGAGCGAGAACCAAGCACGCACTCCCCCTCTCCGAACGTACCTACACCTGCACCGCC
TGCGGAACCGTCTGCCCACGGGACAAGAACTCCGCACGCGTCATGCTCGTCCGGGCTGGT
CTCAACCCGGCTGGTGCCGATGGCAGAAGACCTCCTGGAGCGCTGCTCCAGGAGGCAGCC
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001959 Transposase, probable, IS891/IS1136/IS1341 (Domain)
 [75-288]  3.2e-15 PF01385
PF01385   OrfB_IS605
IPR010095 Transposase IS605, OrfB, C-terminal (Domain)
 [315-376]  5.20000000000001e-11 PF07282
PF07282   OrfB_Zn_ribbon
SignalP
 [1-24]  0.411 Signal
Bacteria, Gram-positive   
TMHMM No significant hit