close all open/close all

CDS information : Ncarz_00400


close this sectionLocation

Organism
StrainATCC 15944
Entry nameNeocarzinostatin
Contig
Start / Stop / Direction66,860 / 65,682 / - [in whole cluster]
66,860 / 65,682 / - [in contig]
Locationcomplement(65682..66860) [in whole cluster]
complement(65682..66860) [in contig]
TypeCDS
Length1,179 bp (392 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative transcriptional regulator
Product (GenBank)transcriptional regulator
GenencsR7
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15797213] The neocarzinostatin biosynthetic gene cluster from Streptomyces carzinostaticus ATCC 15944 involving two iterative type I polyketide synthases. (Chem Biol. , 2005)
Related Reference
ACC
Q8GMD3
NITE
C1027_00600
PmId
[19159491] Role of sgcR3 in positive regulation of enediyne antibiotic C-1027 production of Streptomyces globisporus C-1027. (BMC Microbiol. , 2009)

close this sectionSequence

selected fasta
>putative transcriptional regulator [transcriptional regulator]
MTNASTDARYSIPPYADQLFEHLPRADQRKWARAYLKALLTTQGKKTVRRLAASVSDSPT
ASQSLHQFVNASPWDWMPVRQEIARWAETRLTPQAWLLDFAVIRKRGEHSCGVHRRFDPA
TGRSATCQVGVGAFLATADAAVPVDWRLLLPGSWANDPQRRLRARIPDDLGPQPIEEHAL
ALTDFLMGNSRSSPGPVVADLATVPGAHTLVRGLATRNRDFVIAVPAGFKVVLGRHLHIQ
NPSDANDRGLALAARSLFEFDSGLTRAETVDAADAHMQRLEVKSLRVYLPDTHPSFPPRT
YSLFTVAAENSRRPAQMWLTSLTNARAAEVVALTRLLARSQEAVRRMESDFGLLDFEGRS
YPGWHHHMTLVSAAYAYSRIGHLSAAERAEAA
selected fasta
>putative transcriptional regulator [transcriptional regulator]
GTGACGAACGCCTCGACGGATGCCCGGTACTCAATACCGCCCTACGCGGACCAACTCTTC
GAGCACCTGCCACGTGCCGACCAGCGCAAGTGGGCACGGGCCTACCTCAAAGCCCTCTTG
ACCACTCAGGGAAAGAAGACCGTCCGACGTCTGGCCGCCTCCGTGTCGGACTCCCCGACC
GCATCCCAGTCGTTGCATCAGTTCGTCAACGCGAGCCCCTGGGACTGGATGCCGGTACGG
CAGGAAATAGCACGTTGGGCCGAGACCAGGCTCACCCCCCAGGCCTGGCTTTTGGACTTC
GCGGTGATACGCAAGCGAGGGGAGCACTCCTGCGGTGTGCACCGGCGCTTCGATCCGGCC
ACGGGCCGCTCCGCGACCTGCCAGGTGGGAGTGGGGGCCTTTCTCGCCACCGCCGATGCA
GCCGTTCCGGTCGACTGGCGCCTGCTGCTGCCCGGCTCCTGGGCCAACGACCCCCAAAGA
CGCCTGCGTGCGCGCATCCCTGATGACCTAGGTCCCCAGCCGATCGAGGAACACGCCCTT
GCCCTCACCGACTTCCTCATGGGGAACAGCAGGTCGTCGCCCGGACCGGTTGTCGCCGAT
CTTGCCACTGTGCCGGGCGCCCATACACTCGTCCGCGGTCTGGCGACACGCAACCGTGAC
TTCGTCATCGCCGTCCCGGCCGGTTTCAAAGTGGTTCTCGGTCGGCATCTGCACATCCAG
AACCCGTCCGATGCCAATGACCGTGGCCTGGCCCTGGCCGCCCGAAGCCTGTTCGAATTC
GATTCCGGTCTCACCCGCGCGGAGACGGTCGATGCCGCTGACGCGCACATGCAACGTCTG
GAGGTCAAGTCCCTCCGGGTCTACCTGCCCGATACCCACCCCTCCTTCCCTCCTCGCACC
TACTCACTGTTCACCGTGGCCGCAGAGAACAGCAGGCGGCCGGCACAGATGTGGCTCACC
AGCCTGACGAACGCCCGGGCGGCTGAGGTGGTCGCTCTGACGCGGCTGCTGGCACGCAGC
CAGGAGGCGGTGCGTCGTATGGAGAGCGATTTCGGCCTACTCGACTTCGAAGGACGGTCC
TACCCGGGCTGGCATCACCACATGACCCTGGTGTCTGCGGCATACGCGTACAGCCGGATC
GGACACCTGTCGGCCGCCGAAAGGGCCGAGGCTGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP
 [1-16]  0.243 Signal
Bacteria, Gram-negative   
TMHMM No significant hit