close all open/close all

CDS information : Ncarz_00410


close this sectionLocation

Organism
StrainATCC 15944
Entry nameNeocarzinostatin
Contig
Start / Stop / Direction67,166 / 67,786 / + [in whole cluster]
67,166 / 67,786 / + [in contig]
Location67166..67786 [in whole cluster]
67166..67786 [in contig]
TypeCDS
Length621 bp (206 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative TetR family transcriptional regulator
Product (GenBank)transcriptional regulator
GenencsR3
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15797213] The neocarzinostatin biosynthetic gene cluster from Streptomyces carzinostaticus ATCC 15944 involving two iterative type I polyketide synthases. (Chem Biol. , 2005)
Related Reference
ACC
Q56153
NITE
Jado_00040
PmId
[7592375] Regulation of jadomycin B production in Streptomyces venezuelae ISP5230: involvement of a repressor gene, jadR2. (J Bacteriol. , 1995)
[20562102] "Pseudo" gamma-butyrolactone receptors respond to antibiotic signals to coordinate antibiotic biosynthesis. (J Biol Chem. , 2010)
[23832247] JadR and jadR2 act synergistically to repress jadomycin biosynthesis. (Sci China Life Sci. , 2013)

close this sectionSequence

selected fasta
>putative TetR family transcriptional regulator [transcriptional regulator]
MRQERAERTRAAAVRTTAAEIDLKGYDGTSLSAVSKIAGMSVGALTFHFPSKNDLANAVW
QAGQSLLREAVERVAANRTPPLLRVIELSLVIADLMEKETTVRAAIRLSRESHTPSHWSD
CWVPEVRRLLSEAHRGGQLSEDTPVEDLTVLVQYLVDGTEAYLRARRDTEQGYGSAAAQL
ERLWALVLTGVQDAGALGRNPPPARS
selected fasta
>putative TetR family transcriptional regulator [transcriptional regulator]
GTGAGACAAGAACGAGCTGAACGTACCCGTGCGGCCGCAGTGCGTACTACGGCCGCAGAG
ATCGACCTCAAGGGCTATGACGGTACGTCACTTTCAGCGGTCAGCAAGATCGCAGGCATG
TCCGTGGGGGCACTGACCTTTCACTTTCCCTCGAAGAACGACTTGGCAAACGCCGTCTGG
CAAGCGGGGCAGTCCCTACTGAGGGAGGCAGTGGAGCGTGTGGCGGCCAACCGGACACCT
CCGTTGCTGCGGGTGATCGAGCTCAGTCTGGTCATCGCGGACCTCATGGAGAAGGAGACC
ACCGTGCGTGCCGCCATCCGGCTGTCCCGGGAGTCGCATACCCCGTCCCACTGGTCGGAC
TGCTGGGTGCCGGAAGTACGGCGGCTGCTCAGCGAGGCCCACCGCGGGGGCCAGCTCAGC
GAAGACACACCGGTCGAGGACCTCACCGTCCTGGTGCAGTACCTGGTCGACGGCACCGAG
GCGTACCTCCGGGCCCGGCGCGACACGGAACAGGGGTACGGCAGCGCCGCGGCACAACTC
GAGCGCCTGTGGGCGTTGGTCCTGACAGGGGTGCAGGACGCGGGAGCACTTGGTAGGAAC
CCGCCGCCGGCCCGGTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001647 DNA-binding HTH domain, TetR-type (Domain)
 [16-59]  6.1e-12 PF00440
PF00440   TetR_N
 [7-67]  PS50977
PS50977   HTH_TETR_2
IPR009057 Homeodomain-like (Domain)
 [2-85]  6.00000361638163e-14 SSF46689
SSF46689   Homeodomain_like
IPR011075 Tetracycline transcriptional regulator, TetR-related, C-terminal (Domain)
 [79-205]  2.6999988713206e-08 SSF48498
SSF48498   TetR_like_C
IPR015893 Tetracycline transcriptional regulator, TetR-like, C-terminal (Domain)
 [1-192]  1.1e-28 G3DSA:1.10.357.10
G3DSA:1.10.357.10   TetR_C
SignalP No significant hit
TMHMM No significant hit