close all open/close all

CDS information : Ncarz_00420


close this sectionLocation

Organism
StrainATCC 15944
Entry nameNeocarzinostatin
Contig
Start / Stop / Direction68,811 / 67,831 / - [in whole cluster]
68,811 / 67,831 / - [in contig]
Locationcomplement(67831..68811) [in whole cluster]
complement(67831..68811) [in contig]
TypeCDS
Length981 bp (326 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.6 biosynthesis of butyrolactone
Productputative gamma-butyrolactone biosynthesis enzyme
Product (GenBank)NDP-hexose-2,3-dehydratase
GenencsC2
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15797213] The neocarzinostatin biosynthetic gene cluster from Streptomyces carzinostaticus ATCC 15944 involving two iterative type I polyketide synthases. (Chem Biol. , 2005)
Related Reference
ACC
Q9LBV2
NITE
Virg_00320
PmId
[18034227] Identification by gene deletion analysis of barS2, a gene involved in the biosynthesis of gamma-butyrolactone autoregulator in Streptomyces virginiae. (Arch Microbiol. , 2008)
ACC
Q934T2
NITE
Jado_00020
PmId
[12904539] Control of growth, secondary metabolism and sporulation in Streptomyces venezuelae ISP5230 by jadW(1), a member of the afsA family of gamma-butyrolactone regulatory genes. (Microbiology. , 2003)
[17653711] Engineering a regulatory region of jadomycin gene cluster to improve jadomycin B production in Streptomyces venezuelae. (Appl Microbiol Biotechnol. , 2007)
[25116816] A gamma-butyrolactone-sensing activator/repressor, JadR3, controls a regulatory mini-network for jadomycin biosynthesis. (Mol Microbiol. , 2014)

close this sectionSequence

selected fasta
>putative gamma-butyrolactone biosynthesis enzyme [NDP-hexose-2,3-dehydratase]
MSPPLRVVITGATGFIGSAALRELARSRRSRGTGVGPLVIRALGRREPDTSLIDEWVYAD
LTQPETLAGACSEADVLLHLASFVGSDPDMCERVNTVGTAVLMDDAVRCGIERVVHLSTA
AVYGPGPHRGTTVGELAPAPVSAVSRSRLAGEAHALAAGADVLRTGLVVGEGDRWVIPAV
AKLFDAVPGLWDGGRARVSMIAVEDLARLVVSLVGTGRPSRNRVFHACHPAPLSCGELLR
GLARLELLPSLPEVGELSWQECLRQLRSADCGVSERQFALVARDNWFDSEDIWRVAGCSP
GHGPLRSIEEAAPWYRSLMSARTVTP
selected fasta
>putative gamma-butyrolactone biosynthesis enzyme [NDP-hexose-2,3-dehydratase]
ATGAGCCCTCCACTGCGCGTGGTCATCACCGGAGCCACGGGGTTCATAGGTTCTGCCGCA
CTGCGTGAACTGGCCCGGTCGCGGAGATCCCGAGGCACCGGCGTCGGACCTCTTGTCATC
CGTGCGCTCGGGCGCCGAGAGCCGGACACGTCGCTCATCGACGAGTGGGTGTACGCGGAT
CTGACCCAGCCCGAAACCCTGGCAGGGGCCTGCTCGGAGGCCGACGTGCTGTTGCATCTG
GCCTCGTTCGTCGGTTCGGACCCGGACATGTGCGAGAGGGTCAACACGGTCGGCACGGCG
GTGCTCATGGACGACGCAGTCCGTTGTGGAATCGAGCGAGTCGTTCACCTTTCGACGGCC
GCCGTCTACGGGCCGGGTCCCCATCGCGGCACCACCGTCGGCGAGCTCGCGCCCGCGCCC
GTCTCGGCCGTGAGCCGCTCACGGCTCGCCGGCGAGGCACACGCACTCGCCGCGGGGGCC
GACGTGCTTCGCACCGGCCTGGTGGTAGGAGAGGGCGACCGCTGGGTGATCCCGGCCGTG
GCCAAGCTTTTCGACGCGGTCCCCGGCCTGTGGGACGGAGGGCGGGCACGTGTCTCCATG
ATCGCGGTGGAGGACTTGGCCCGCCTCGTCGTCAGTCTGGTCGGCACGGGACGCCCCTCT
CGCAACAGGGTGTTCCATGCGTGCCATCCGGCGCCCCTGAGCTGTGGCGAGTTACTGAGG
GGCCTCGCCCGACTGGAGCTGCTGCCGTCGCTGCCGGAGGTGGGCGAGTTGTCCTGGCAG
GAGTGCCTTCGGCAACTGCGCTCCGCCGATTGCGGTGTCAGTGAACGCCAGTTCGCACTC
GTCGCCCGCGACAACTGGTTCGACAGCGAGGACATTTGGCGGGTGGCCGGCTGCTCACCA
GGACACGGCCCTCTTCGCAGCATCGAGGAAGCCGCCCCCTGGTACCGGTCGCTCATGTCT
GCCCGGACGGTGACGCCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [7-222]  1.6e-23 PF01370
PF01370   Epimerase
IPR016040 NAD(P)-binding domain (Domain)
 [6-244]  1.99999999999999e-37 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-20]  0.522 Signal
Eukaryota   
TMHMM No significant hit