close all open/close all

CDS information : Ncarz_00430


close this sectionLocation

Organism
StrainATCC 15944
Entry nameNeocarzinostatin
Contig
Start / Stop / Direction69,434 / 68,808 / - [in whole cluster]
69,434 / 68,808 / - [in contig]
Locationcomplement(68808..69434) [in whole cluster]
complement(68808..69434) [in contig]
TypeCDS
Length627 bp (208 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative TetR family transcriptional regulator
putative gamma-butyrolactone receptor
Product (GenBank)butyrolactone receptor
GenencsR2
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15797213] The neocarzinostatin biosynthetic gene cluster from Streptomyces carzinostaticus ATCC 15944 involving two iterative type I polyketide synthases. (Chem Biol. , 2005)
Related Reference
ACC
Q6L8I2
PmId
[15150228] Cloning and functional analysis by gene disruption of a gene encoding a gamma-butyrolactone autoregulator receptor from Kitasatospora setae. (J Bacteriol. , 2004)
ACC
Q60011
NITE
Virg_00340
PmId
[9371444] Butyrolactone autoregulator receptor protein (BarA) as a transcriptional regulator in Streptomyces virginiae. (J Bacteriol. , 1997)
ACC
C1KEU4
PmId
[19465647] Characterization of gamma-butyrolactone autoregulatory signaling gene homologs in the angucyclinone polyketide WS5995B producer Streptomyces acidiscabies. (J Bacteriol. , 2009)

close this sectionSequence

selected fasta
>putative TetR family transcriptional regulator [butyrolactone receptor]
MAEPKQERATRTRALILRAAAEVFDESGYSGASISKIMNRAGVTQGGMYFHFKSKKRLAL
AVMSSQQTFIDFPSEGAGLQRVIDLTFHLAHELQTNPLIRASIRLAVEQGEFGVRDDTAY
QDWVALVETYLLEARQRGELLPEVDEHDFAVVLVSAFTGSQLFSSVASARADLPSRIVLL
WRYLLPGLTPPRTRASLRVEPADRTPAT
selected fasta
>putative TetR family transcriptional regulator [butyrolactone receptor]
ATGGCCGAACCGAAGCAGGAACGGGCCACGAGGACACGAGCGTTGATCCTCCGTGCCGCT
GCTGAGGTGTTCGACGAGAGCGGATACAGCGGGGCGAGCATCAGTAAAATCATGAACCGC
GCCGGCGTGACCCAGGGGGGCATGTACTTCCACTTCAAGTCGAAGAAGAGGCTGGCCCTG
GCAGTGATGAGCAGTCAGCAGACCTTCATCGACTTCCCCTCAGAAGGTGCCGGTCTGCAG
CGAGTGATCGACCTCACCTTCCACCTCGCTCACGAGCTCCAGACCAACCCCCTGATCCGG
GCCAGCATCCGGCTCGCCGTCGAGCAGGGAGAGTTCGGCGTCCGCGACGACACCGCCTAC
CAGGACTGGGTAGCCCTGGTGGAGACCTACCTGCTGGAGGCGCGCCAGCGGGGCGAACTG
CTCCCGGAGGTGGACGAACACGACTTCGCCGTCGTTCTCGTCAGCGCGTTCACCGGTAGC
CAGCTGTTCTCGAGCGTCGCCAGCGCCCGTGCGGATCTGCCCAGCAGGATCGTCCTGCTG
TGGCGTTATCTGCTGCCTGGCCTCACGCCCCCTCGGACGAGGGCCTCCCTGCGGGTCGAG
CCGGCGGACAGGACCCCGGCCACATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001647 DNA-binding HTH domain, TetR-type (Domain)
 [10-70]  PS50977
PS50977   HTH_TETR_2
 [16-29]  3.0999994589937e-11 PR00455 [37-60]  3.0999994589937e-11 PR00455
PR00455   HTHTETR
 [16-62]  1.7e-15 PF00440
PF00440   TetR_N
IPR009057 Homeodomain-like (Domain)
 [1-63]  7.49999605851445e-15 SSF46689
SSF46689   Homeodomain_like
IPR011075 Tetracycline transcriptional regulator, TetR-related, C-terminal (Domain)
 [76-208]  3.49999466863949e-28 SSF48498
SSF48498   TetR_like_C
IPR015893 Tetracycline transcriptional regulator, TetR-like, C-terminal (Domain)
 [10-192]  2.5e-32 G3DSA:1.10.357.10
G3DSA:1.10.357.10   TetR_C
IPR023772 DNA-binding HTH domain, TetR-type, conserved site (Conserved_site)
 [28-58]  PS01081
PS01081   HTH_TETR_1
SignalP No significant hit
TMHMM No significant hit