close all open/close all

CDS information : Ncarz_00440


close this sectionLocation

Organism
StrainATCC 15944
Entry nameNeocarzinostatin
Contig
Start / Stop / Direction69,554 / 70,507 / + [in whole cluster]
69,554 / 70,507 / + [in contig]
Location69554..70507 [in whole cluster]
69554..70507 [in contig]
TypeCDS
Length954 bp (317 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.6 biosynthesis of butyrolactone
Productputative gamma-butyrolactone biosynthesis enzyme
putative regulatory protein
Product (GenBank)transcriptional regulator
GenencsR1
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15797213] The neocarzinostatin biosynthetic gene cluster from Streptomyces carzinostaticus ATCC 15944 involving two iterative type I polyketide synthases. (Chem Biol. , 2005)
Related Reference
ACC
O24738
NITE
Virg_00330
PmId
[10792718] Identification of an AfsA homologue (BarX) from Streptomyces virginiae as a pleiotropic regulator controlling autoregulator biosynthesis, virginiamycin biosynthesis and virginiamycin M1 resistance. (Mol Microbiol. , 2000)
[19778967] Null mutation analysis of an afsA-family gene, barX, that is involved in biosynthesis of the {gamma}-butyrolactone autoregulator in Streptomyces virginiae. (Microbiology. , 2010)
ACC
Q83X19
NITE
Lanka_00850*
PmId
[12791134] The large linear plasmid pSLA2-L of Streptomyces rochei has an unusually condensed gene organization for secondary metabolism. (Mol Microbiol. , 2003)
[17526839] gamma-Butyrolactone autoregulator-receptor system involved in lankacidin and lankamycin production and morphological differentiation in Streptomyces rochei. (Microbiology. , 2007)
ACC
P18394
PmId
[17277085] Biosynthesis of gamma-butyrolactone autoregulators that switch on secondary metabolism and morphological development in Streptomyces. (Proc Natl Acad Sci U S A. , 2007)

close this sectionSequence

selected fasta
>putative gamma-butyrolactone biosynthesis enzyme [transcriptional regulator]
MLGTDDRPGPVEPALTRTVAKEYVHRAALAEVFLTGWNRTGPDSFLVSAQWPRSHSFYSS
DRGVHDPLLLCESLRQCGLLLTHAAFKVPFGYQLSWSSLRYSANPEAMRIGSTPADIEMH
VQCTDVRYRRSLPVAMTMRIEVVLDSALLAVATITFGQHAPAVYRRLRAGRSDAAGLCAN
APTPAAPIPPYVAGRTRQEDVVLSPTEDRLRWRLRVDTNHPVLFDHPVDHVPGMLLLESV
RQAGHAVHPSGGDVMPTLMDVSFNRYVELDEPCWIEAEAMPSPAGSRKATRVNGLQGGRL
AFTAVTQMTDITGSPPC
selected fasta
>putative gamma-butyrolactone biosynthesis enzyme [transcriptional regulator]
ATGCTTGGTACGGACGACCGTCCGGGCCCCGTTGAACCCGCACTGACCAGGACCGTTGCA
AAGGAGTACGTACACAGGGCCGCGCTCGCGGAAGTGTTCTTGACGGGCTGGAACAGGACC
GGCCCCGACTCATTTCTTGTCAGCGCCCAGTGGCCGCGCTCTCACAGCTTCTACAGCTCC
GATCGCGGTGTCCACGACCCGCTGCTTCTGTGTGAAAGCCTACGTCAGTGTGGCCTGTTG
CTGACCCACGCAGCGTTCAAGGTGCCCTTCGGCTACCAGCTCAGCTGGTCCAGCCTGCGG
TACTCGGCCAACCCCGAGGCGATGCGTATCGGCAGCACCCCCGCCGACATCGAAATGCAT
GTACAGTGCACCGATGTTCGGTACCGGCGCTCCCTGCCCGTCGCGATGACCATGCGCATC
GAGGTGGTGCTCGACTCGGCCCTTCTGGCCGTCGCCACCATCACGTTCGGCCAGCACGCC
CCGGCTGTGTACCGCCGTCTCAGAGCCGGACGGTCGGACGCAGCCGGTCTGTGCGCGAAC
GCCCCGACCCCGGCTGCACCCATCCCCCCGTACGTGGCCGGACGCACCAGGCAGGAGGAC
GTAGTCCTGTCGCCCACGGAAGACCGACTGCGCTGGCGGCTGCGGGTCGACACCAACCAC
CCGGTGCTCTTCGACCACCCGGTCGACCATGTTCCGGGCATGCTGCTCCTGGAGTCCGTA
CGGCAAGCAGGCCATGCTGTACATCCGTCCGGCGGCGACGTGATGCCGACGTTGATGGAC
GTGTCGTTCAACCGCTACGTGGAGCTCGACGAACCCTGCTGGATAGAGGCGGAAGCGATG
CCTTCCCCTGCCGGATCACGAAAGGCGACACGTGTCAACGGTCTTCAAGGCGGGAGACTC
GCCTTCACGGCCGTCACTCAAATGACGGACATAACCGGCTCCCCTCCCTGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005509 A-factor biosynthesis hotdog domain (Domain)
 [23-156]  8.1e-37 PF03756 [193-309]  3.09999999999998e-35 PF03756
PF03756   AfsA
SignalP No significant hit
TMHMM No significant hit