close all open/close all

CDS information : Ncarz_00450


close this sectionLocation

Organism
StrainATCC 15944
Entry nameNeocarzinostatin
Contig
Start / Stop / Direction71,611 / 70,817 / - [in whole cluster]
71,611 / 70,817 / - [in contig]
Locationcomplement(70817..71611) [in whole cluster]
complement(70817..71611) [in contig]
TypeCDS
Length795 bp (264 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)unknown
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15797213] The neocarzinostatin biosynthetic gene cluster from Streptomyces carzinostaticus ATCC 15944 involving two iterative type I polyketide synthases. (Chem Biol. , 2005)

close this sectionSequence

selected fasta
>hypothetical protein [unknown]
MSAVASAVDVAGAVFLVLWAVAMWLAVCLLAWANRGPVKPWLYRGSVAVIGLGVIGQVGH
FQEHVAQAAYWIANPDAPAWMTPWGDGLARGMGVVDPDNPTLGMEILHLTGNYVFLAGLV
GIMLITSRAVTELKSRRWARMGVWMQGIHGLEHVALTVSVALGADRAIGLSTWFGAIPPG
SALTTYRVWWHFVANLVGTAILTVAVFHLWRERRSVRLSYAGGASDSGEQRDGVVGSPRR
EPTTKAGLADSDTQASTVLTEHVP
selected fasta
>hypothetical protein [unknown]
ATGAGCGCCGTCGCGAGCGCCGTCGATGTTGCGGGTGCCGTGTTCCTCGTCCTGTGGGCC
GTCGCGATGTGGCTGGCCGTGTGCCTCCTCGCTTGGGCGAACAGAGGTCCGGTGAAGCCC
TGGTTGTACCGGGGCTCGGTGGCGGTGATCGGTCTCGGCGTCATCGGCCAGGTCGGGCAC
TTCCAGGAACACGTCGCCCAGGCGGCCTACTGGATAGCGAATCCCGACGCACCCGCCTGG
ATGACGCCGTGGGGCGACGGCCTGGCCCGCGGCATGGGCGTCGTCGACCCGGACAATCCC
ACGCTGGGAATGGAGATCCTGCATCTGACGGGCAACTACGTCTTCCTGGCCGGACTGGTC
GGCATCATGCTGATCACCAGCCGGGCGGTAACGGAACTGAAGTCTCGCCGGTGGGCGCGG
ATGGGGGTCTGGATGCAAGGCATTCATGGGCTCGAGCACGTTGCGCTGACGGTCTCCGTG
GCCCTTGGCGCCGACCGTGCCATCGGACTTTCCACCTGGTTCGGTGCCATCCCCCCGGGT
TCGGCCCTGACGACGTACCGCGTCTGGTGGCACTTCGTGGCCAACCTCGTCGGTACGGCG
ATCCTGACCGTCGCGGTCTTTCACCTGTGGCGTGAGCGGCGAAGCGTCAGGTTGTCCTAC
GCGGGCGGGGCATCCGATTCCGGCGAGCAGCGGGACGGTGTCGTCGGTTCCCCTCGGCGG
GAGCCGACGACGAAGGCAGGACTCGCTGATTCGGACACGCAAGCGTCGACCGTCCTGACG
GAACACGTCCCCTAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-33]  0.475 Signal
Bacteria, Gram-negative   
 [1-33]  0.916 Signal
Eukaryota   
 [1-33]  0.555 Signal
Bacteria, Gram-positive   
TMHMM
 [10-32]  Transmembrane (o-i) [41-60]  Transmembrane (i-o) [109-131]  Transmembrane (o-i) [151-173]  Transmembrane (i-o) [188-210]  Transmembrane (o-i)
Transmembrane 5