close all open/close all
Ncarz_00460 Ncarz_00460   last last

CDS information : Ncarz_00470


close this sectionLocation

Organism
StrainATCC 15944
Entry nameNeocarzinostatin
Contig
Start / Stop / Direction74,485 / 74,985 / + [in whole cluster]
74,485 / 74,985 / + [in contig]
Location74485..74985 [in whole cluster]
74485..74985 [in contig]
TypeCDS
Length501 bp (166 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
Reference
PmId
[15797213] The neocarzinostatin biosynthetic gene cluster from Streptomyces carzinostaticus ATCC 15944 involving two iterative type I polyketide synthases. (Chem Biol. , 2005)

close this sectionSequence

selected fasta
>hypothetical protein
MRTRRILTAAAATAAVTGLGLAAAAPVQAAEYSSALKIKGIQYDAPGRDSNKCTGGNTAS
EYLTIKNYSRSNVNLKGYVVKDAAGNSYTFKTNHILEPGDQVSLRGGRGTDSDAKNVAYR
QNCNFMWNNDKDTIYLYKPGGARADVHSYTQKTNDRDGNGYITYHG
selected fasta
>hypothetical protein
ATGCGCACCCGTCGCATCCTGACCGCCGCCGCAGCCACCGCCGCCGTCACCGGACTCGGC
CTGGCCGCAGCCGCTCCAGTCCAGGCCGCCGAGTACTCCTCGGCCCTGAAGATCAAGGGC
ATCCAGTACGACGCCCCCGGCCGGGACTCCAACAAGTGCACCGGCGGCAACACCGCCAGC
GAGTACCTGACGATCAAGAATTACTCGCGGAGCAACGTCAACCTGAAGGGCTACGTCGTC
AAGGACGCCGCTGGCAACAGCTACACCTTCAAGACCAACCACATCCTCGAGCCCGGTGAC
CAGGTCAGCCTCCGCGGCGGACGAGGCACCGACAGCGACGCCAAGAACGTCGCCTACCGG
CAGAACTGCAACTTCATGTGGAACAACGACAAGGACACCATCTACCTGTACAAGCCCGGC
GGCGCCCGCGCCGACGTCCACTCGTACACGCAGAAGACCAACGACCGCGACGGCAACGGC
TACATCACCTACCACGGGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001322 Lamin Tail Domain (Domain)
 [39-152]  1.3e-24 PF00932
PF00932   LTD
IPR006311 Twin-arginine translocation pathway, signal sequence (Conserved_site)
 [1-30]  7.728 PS51318
PS51318   TAT
SignalP
 [1-29]  0.794 Signal
Bacteria, Gram-negative   
 [1-29]  0.674 Signal
Eukaryota   
 [1-29]  0.788 Signal
Bacteria, Gram-positive   
TMHMM
 [7-29]  Transmembrane (i-o)
Transmembrane 1   
Ncarz_00460 Ncarz_00460   last last