close all open/close all
first first   Nidda_00020 Nidda_00020

CDS information : Nidda_00010


close this sectionLocation

Organism
StrainNRRL 2821
Entry nameNiddamycin
Contig
Start / Stop / Direction396 / 1 / - [in whole cluster]
396 / 1 / - [in contig]
Locationcomplement(1..396) [in whole cluster]
complement(1..396) [in contig]
TypeCDS
Length396 bp (131 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative cytochrome P450(fragment)
Product (GenBank)cytochrome P-450 hydroxylase homolog
Gene
Gene (GenBank)nidi
EC number
Keyword
Note
Note (GenBank)
  • ORF6; similar to tyli
Reference
ACC
PmId
[9393718] Identification and characterization of the niddamycin polyketide synthase genes from Streptomyces caelestis. (J Bacteriol. , 1997)
Related Reference
ACC
P48635
PmId
[8416893] Identification of a Saccharopolyspora erythraea gene required for the final hydroxylation step in erythromycin biosynthesis. (J Bacteriol. , 1993)
[7849045] Overproduction and characterization of the erythromycin C-12 hydroxylase, EryK. (Biochemistry. , 1995)

close this sectionSequence

selected fasta
>putative cytochrome P450(fragment) [cytochrome P-450 hydroxylase homolog]
MVDSVTGPMELSKDANAKELLDWFSHNRTHHPVFWDEGRQAWQVFRYDDYLTVSNHPEFF
SSDFTEVAPTPPELEMILGPGTIGALDPPAHGPMRKLVSQAFTPRRMAGQEQRIRVIAEE
LLDRVRGQKTIA
selected fasta
>putative cytochrome P450(fragment) [cytochrome P-450 hydroxylase homolog]
ATGGTCGACAGCGTGACTGGGCCGATGGAGCTCAGCAAGGACGCGAATGCCAAGGAGCTG
CTCGACTGGTTCAGCCATAACCGGACCCACCACCCCGTCTTCTGGGACGAGGGCCGTCAA
GCGTGGCAGGTGTTCCGGTATGACGACTACCTGACCGTCTCGAATCATCCCGAGTTTTTC
TCGTCGGATTTCACGGAGGTCGCGCCGACCCCGCCCGAGCTGGAGATGATCCTCGGGCCC
GGCACCATCGGCGCCCTGGACCCGCCCGCCCACGGCCCCATGCGCAAGCTGGTCAGCCAG
GCGTTCACACCCCGGCGGATGGCCGGTCAGGAACAGCGGATCCGGGTCATCGCCGAGGAA
CTGCTGGACCGGGTGCGTGGGCAGAAGACCATCGCG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [7-130]  4.80000000000001e-20 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
 [18-127]  5.59999989417023e-16 SSF48264
SSF48264   Cytochrome_P450
SignalP
 [1-35]  0.051 Signal
Bacteria, Gram-negative   
TMHMM No significant hit
first first   Nidda_00020 Nidda_00020