close all open/close all

CDS information : Nidda_00020


close this sectionLocation

Organism
StrainNRRL 2821
Entry nameNiddamycin
Contig
Start / Stop / Direction627 / 13,649 / + [in whole cluster]
627 / 13,649 / + [in contig]
Location627..13649 [in whole cluster]
627..13649 [in contig]
TypeCDS
Length13,023 bp (4,340 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)polyketide synthase modules 1 and 2
Gene
Gene (GenBank)nidA1
EC number
Keyword
Note
Note (GenBank)
  • orf1
Reference
ACC
PmId
[9393718] Identification and characterization of the niddamycin polyketide synthase genes from Streptomyces caelestis. (J Bacteriol. , 1997)

close this sectionPKS/NRPS Module

0 malonyl-CoA
1 malonyl-CoA
2 malonyl-CoA
KSQ24..377
AT538..845
ACP905..979
KS1007..1381
AT1530..1841
KR2092..2269
ACP2370..2440
KS2466..2842
AT2990..3301
DH3354..3522
KR3865..4045
ACP4160..4230

close this sectionSequence

selected fasta
>polyketide synthase [polyketide synthase modules 1 and 2]
MAGHGDATAQKAQDAEKSEDGSDAIAVIGMSCRFPGAPGTAEFWQLLSSGADAVVTAADG
RRRGTIDAPADFDAAFFGMSPREAAATDPQQRLVLELGWEALEDAGIVPESLRGEAASVF
VGAMNDDYATLLHRAGAPTDTYTATGLQHSMIANRLSYFLGLRGPSLVVDTGQSSSLVAV
ALAVESLRGGTSGIALAGGVNLVLAEEGSAAMERVGALSPDGRCHTFDARANGYVRGEGG
AIVVLKPLADALADGDRVYCVVRGVATGNDGGGPGLTVPDRAGQEAVLRAACDQAGVRPA
DVRFVELHGTGTPAGDPVEAEALGAVYGTGRPANEPLLVGSVKTNIGHLEGAAGIAGFVK
AALCLHERALPASLNFETPNPAIPLERLRLKVQTAHAALQPGTGGGPLLAGVSAFGMGGT
NCHVVLEETPGGRQPAETGQADACLFSASPMLLLSARSEQALRAQAARLREHLEDSGADP
LDIAYSLATTRTRFEHRAAVPCGDPDRLSSALAALAAGQTPRGVRIGSTDADGRLALLFT
GQGAQHPGMGQELYTTDPHFAAALDEVCEELQRCGTQNLREVMFTPDQPDLLDRTEYTQP
ALFALQTALYRTLTARGTQAHLVLGHSVGEITAAHIAGVLDLPDAARLITARAHVMGQLP
HGGAMLSVQAAEHDLDQLAHTHGVEIAAVNGPTHCVLSGPRTALEETAQHLREQNVRHTW
LKVSHAFHSALMDPMLGAFRDTLNTLNYQPPTIPLISNLTGQIADPNHLCTPDYWIDHAR
HTVRFADAVQTAHHQGTTTYLEIGPHPTLTTLLHHTLDNPTTIPTLHRERPEPETLTQAI
AAVGVRTDGIDWAVLCGASRPRRVELPTYAFQRRTHWAPGLTPNHAPADRPAAEPQRAMA
VGPVSREALVRLVGETTASVLGLDGPDEVALDRPFTSQGLDSMTAVELAGLLGTAAGVAL
DPTLVYELPTPRAVADHLAKTLLGESAADADQEVNGRTGEAEAKAGDPIAVIGIGCRFPG
GVATPDDLWELVASGTDAISTFPTDRGWDLDGLYDPDPSTPGKSYVRHGGFLHDAAQFDA
EFFGISPREATAMDPQQRLLLETSWEALERAGVVPESLRGGRTGVFVGTTAPEYGPRLHE
GTDGYEGFLLTGTTASVASGRIAYALGTRGPALTVDTACSSSLVALHLAVQSLRRGECDL
ALAGGTTVMSGPGMFVEFSRQRGLAPDGRCKAFSADADGTAWAEGVGMLLVERLSDAERL
GHRVLAVVRGTAVNQDGASNGLTAPSGPAQQQVIRDALSDAGLSADDIDAVEAHGTGTAL
GDPIEAGALLATYGHPKRQTPVWLGSLKSNIGHTQAAAGIAGIIKMVQALRHDTLPRTLH
ADHPSSKVDWDAGPLQLLTDARPWPADPDRPRRAGISAFGVSGTNAHVVLEEPPAPEEAP
ARTQAPPPVIAWPLSAHTPTALRAQAARLDSWLHHTQADPQDIAHALATTRTHFKHRAVI
TGRTRTELHTKLHTLDAIQGTAHPHPRLTLLFTGQGAQHRGMGQELYATDPHFAAALDEV
CEELQRCGTQNLREVMFTPDQPDLLDRTEYTQPALFALQTALYRTLTARGTQAHLVLGHS
VGEITAAHIAGVLDLPDAARLITARAHLMGQLPHGGAMLSVQAAEHDLDQLAHTHGVEIA
AVNGPTHCVLSGPRTALEETAQQLHQQGIRHTWLKVSHAFHSALMDPMLGAFRDTLNTLN
YQPPTIPLISNLTGQIADPNHLCTPDYWIDHARHTVRFADAVQTAHDQRTTTYLEIGAHP
TLTTLLHHTLDNPTTIPTLHREHPEPETLTTALATLHTTGHTTTLHTTSPQTHHLDLPTY
PFQRDRYWMEPVRVAQVSGQPGADRLRYRVVWEAAPEDHTVPSAERWLLLGGSDPADAGI
LVGVEEQLVGHGAAVQRLDIPAPAGRRLLPSCSELPVRGPSHTGEFCGSRLRSPRVAEAV
ALLQALGDAGADAPLWIATRGAVAAQAGEAPSVGGAQLWGLGQVAGLELADRWGGLVDLP
ADPAPAALRGLARVLVSNAPDNQVAIRASGVFVRRVVPAPGRPVRNDWAPSGTVLITGGT
GALGSQVARRLALAGAPHLLLAGRRGNSGAAELVDELTALGAEVTVAACDAADRDALVSL
LATIPEHRPLTAVLHAAGVLDDGVLDGLTPERIDAVLRAKATAARHLDELTADLDLDAFV
LFSSIVGVWGNGGQATYAAANAALDALAHGRRARGQRATSIAWGPWAGSGMAAGDGAKSL
ARDGIDVLEPEEALDLLEQAVRSDETTLLVADVDWETFLSSSASRRFQLPLFGRIPAARA
VAVSGADGSPDDVPVWLSPQLSAAERQLRLLDLVRTEAASVLRHGSATAVDAETAFRAGG
FDSLTLVELRNRLASATGLRLSNTLLFDHPTPAAVAEYLGEQLLGTEPSAAASHGDAGAR
TVVASDEPVAVVGMACRYPGGVATPDDLWELVASGTDAISTFPTDRGWDLDGLYDPDPST
PGKSYVRHGGFLHDAAQFDAEFFGISPREATAMDPQQRLLLETSWEALEHAGIAPHTLRT
TRTGVFTGASQQEYGTQSREAADKYGGHLLTGTLASVMSGRVAYTLGLQGPALTVDTACS
SSLVALHLAVQSLRRGECDLALAGGSTVMSTPTVFVEFSRQRGLAPDGRCKPFADTADGT
AWAEGVGVLLVERLSDAERLGHRVLAVVRGTAVNQDGASNGLTAPSGPAQQQVIRDALSD
AGLSADDIDAVEAHGTGTPLGDPIEAEALLATYGHPERQTPVWLGSLKSNIGHSQAAAGI
AGIIKMIQAMHHGTLPRTLHVDAPTSQVDWEAGSLQLLAEARPWPADPDRPRRAGISAFG
VSGTNAHVVLEEPPAPEEAPARTQAPPPVIAWPLSAHTPTALRAQAARLDSWLHHTQADP
QDIAHALATTCTHFKHRAVITGRTRTELHTKLHTLDAIQGTAHPHPRLTLLFTGQGAQHP
GMGQELYTTDPHFAAALDEICEELQRCGTQNLREVMFTPDQPDLLDRTEYTQPALFALQT
ALYRTLTAHGTQAHLVLGHSVGEITAAHIAGVLDLPDAARLITARAHLMGQLPHDGAMLS
VQAAEHDLDQLAHTHGVEIAAVNGPTHCVLSGPRTALEETAQHLREQNVRHTWLKVSHAF
HSALMDPMLGAFRDTLNTLNYQPPTIPLISNLTGQIADPNHLCTPDYWIDHARHTVRFAD
AVQTAHDQRTTTYLEIGPHPTLTTLLHHTLDNPTTIPTLHREHPEPETLTTALATLHTTG
HTTTPHPSHIPAQRVSLPAYPFQRRAYWMPNSAAHIGRSDAEAATRLGLARQDHPFLTGA
TSIVGSGATLLTGRVSLAAHPWLADHTVAGAVLFPGTAFADLLLHVAEETGSGTVEELTL
HVPLVLPAQGAVQLQVLVEAPDERGRRAATVAARPEEETGAEWTTHAAGVLAGAEPAAPA
VDWADWAAGAWPPPGAEAVDVDELYAEFAAAGYDYGPAFTGLTGAWRRGEEVFADVRLPE
AVAGSGEEERRFGVHPALFDAALHPWRVGGPWQESGPDADGGQSTLLPFSWQGLTLYGTG
AEQVRVRLAPSDGGAFSVRAADPAGHPVLALDALVLRRVPSSTPGALPAAPMYHIDWQPV
DSTSLVDTRRYAVVGADADETAEVLRAFLPDAHTTAHADLAALRAAPDAVAPTPGPALVV
ALIPGSPPPAPEATSAPDPVRATLAHGLSLVQALIEDERLTTGTTLAVVTRGAVEATQTD
VPDLAGAALWGLVRSAQSEYPGRFRLIDVDDSPESRAALATALASDEPQLALRAGVMLAP
ALTPAEAAGSPAPADAAPTAHGMDGTVLLTGCTGALGRRVAVHLARRHGVRRMLLVSRSG
PNAPESAALERELTELGVHTSFVSCDLADPADVRKAVAGVPSDHPLTGVVHTAGVLDDGA
LARLTPERIDTVLRAKADAVRHLHEATLGHPLRAFVLFSAAAGLLGRPGQASYAAANAVL
DAFARLRRAEGLPAVSLAWGLWDEREGMAGGLDATALRRLRRDGILPMPADQALELLDQA
LTTYRDGPALLVPLLLDSTALRRTAGENGPASVPPLLRSLVPSHPRRHRTTTATSVRDES
GPGPSARLAALPAKERMTVLLDTVSEQVAGVLGHASAAEIDPERPFHEIGFDSLATLELR
NRLGRLVGLRLPSTLAFDHPTPRKVAEWINAELPAANPALGTSAEDPVLTGIDQMARAIA
LMDAEDGRRADVRQRLVGLLTALDRPASGADSTRAAATTVADRLDEATDDEIFAFLDEQL
EEQPDEPLGAPLDERLDEQP
selected fasta
>polyketide synthase [polyketide synthase modules 1 and 2]
ATGGCAGGGCATGGTGACGCCACCGCGCAAAAGGCGCAGGACGCGGAGAAAAGCGAAGAC
GGGTCCGATGCCATCGCTGTCATCGGCATGTCCTGCCGTTTTCCAGGCGCACCGGGAACG
GCGGAATTCTGGCAGCTGCTGAGCAGCGGGGCCGACGCGGTCGTCACGGCGGCCGACGGC
CGGCGGCGCGGCACGATCGACGCCCCCGCGGACTTCGACGCCGCCTTCTTCGGCATGTCA
CCCCGCGAGGCCGCCGCCACCGACCCGCAGCAGCGCCTGGTGCTCGAACTCGGCTGGGAG
GCGCTGGAGGACGCCGGGATCGTGCCGGAGTCACTGCGCGGTGAGGCGGCGAGCGTGTTC
GTCGGCGCCATGAACGACGACTACGCGACGCTGCTGCACCGCGCCGGTGCCCCGACCGAC
ACCTACACCGCCACCGGCCTCCAGCACTCGATGATCGCCAACCGGCTGTCGTACTTCCTC
GGCCTGCGCGGCCCGAGCCTGGTGGTCGACACCGGTCAGTCGTCCTCGCTGGTCGCCGTG
GCCCTCGCGGTGGAGAGCCTGCGCGGCGGAACGTCCGGGATCGCCCTCGCCGGAGGCGTC
AACCTGGTCCTCGCCGAGGAGGGTTCGGCCGCCATGGAACGGGTCGGAGCCCTGTCGCCC
GACGGCCGCTGCCACACGTTCGACGCCCGCGCCAACGGTTACGTACGCGGCGAGGGCGGC
GCCATCGTCGTTCTCAAGCCTCTCGCCGACGCGCTGGCCGACGGCGACCGGGTGTACTGC
GTCGTACGCGGCGTCGCGACCGGCAACGACGGCGGTGGCCCTGGGCTGACCGTCCCCGAC
CGCGCCGGCCAGGAAGCGGTGCTCCGGGCGGCCTGCGACCAGGCCGGGGTACGCCCCGCG
GACGTACGCTTCGTCGAACTGCACGGCACCGGCACCCCCGCCGGTGACCCGGTCGAAGCC
GAGGCGCTCGGCGCGGTGTACGGCACCGGACGCCCCGCGAACGAGCCCCTCCTGGTGGGC
TCGGTCAAGACCAACATCGGGCACCTGGAAGGCGCCGCCGGTATCGCCGGGTTCGTCAAG
GCCGCGCTCTGCCTGCACGAACGGGCGCTGCCCGCGTCCCTGAACTTCGAGACGCCGAAT
CCGGCGATACCGCTGGAGCGGCTGCGGCTGAAGGTGCAGACGGCGCACGCGGCACTCCAG
CCCGGTACCGGGGGCGGGCCACTGCTTGCCGGAGTCAGCGCGTTCGGGATGGGCGGCACC
AATTGCCATGTGGTGCTGGAAGAGACGCCCGGGGGGAGGCAGCCGGCCGAAACGGGGCAG
GCGGATGCGTGCCTCTTCTCCGCGTCACCGATGCTGCTGCTGTCGGCCCGCTCGGAGCAG
GCGTTGCGGGCGCAGGCGGCACGTCTGCGCGAACACCTGGAAGACTCCGGCGCCGACCCG
CTGGACATCGCCTACTCGCTGGCCACCACACGCACCCGGTTCGAGCACCGCGCGGCAGTG
CCCTGCGGGGACCCGGACCGCCTGTCCTCGGCCCTCGCCGCACTGGCCGCCGGGCAGACT
CCCCGGGGCGTGCGGATCGGCAGCACGGACGCGGACGGCCGCCTGGCGCTGCTCTTCACC
GGCCAAGGAGCCCAGCACCCCGGCATGGGCCAGGAGCTCTACACCACAGACCCGCACTTC
GCCGCCGCCCTGGACGAAGTCTGCGAAGAACTACAACGCTGCGGCACCCAGAACCTGCGC
GAGGTGATGTTCACCCCCGACCAGCCGGACCTGCTGGACCGCACCGAATACACCCAGCCC
GCACTCTTCGCCCTGCAAACCGCCCTCTACCGCACCCTGACAGCCCGCGGCACACAAGCC
CACCTCGTCCTGGGCCACTCCGTCGGCGAAATCACCGCAGCCCACATCGCCGGCGTCCTC
GACCTGCCCGACGCCGCACGCCTGATCACCGCACGCGCACACGTCATGGGACAACTCCCC
CACGGCGGCGCCATGCTCTCCGTCCAAGCCGCAGAACACGACCTCGACCAACTCGCACAC
ACCCACGGCGTCGAGATCGCCGCCGTCAACGGACCCACCCACTGCGTCCTGTCCGGACCC
CGCACCGCCCTGGAAGAAACCGCCCAGCACCTACGCGAGCAAAACGTGCGCCACACGTGG
CTGAAGGTCTCCCACGCCTTCCACTCCGCCCTCATGGACCCCATGCTCGGCGCCTTCCGC
GACACCCTCAACACCCTCAACTACCAACCCCCCACCATCCCCCTCATCTCCAACCTCACC
GGCCAGATCGCCGACCCCAACCACCTCTGCACCCCCGACTACTGGATCGACCACGCACGC
CACACCGTCCGCTTCGCCGACGCCGTCCAGACCGCCCACCACCAAGGCACCACCACCTAC
CTGGAAATCGGCCCCCACCCCACCCTCACCACCCTGCTCCACCACACCCTCGACAACCCC
ACCACCATCCCCACCCTCCACCGCGAACGCCCCGAACCAGAAACCCTCACGCAGGCCATC
GCGGCCGTCGGCGTGCGGACTGACGGCATCGACTGGGCCGTACTCTGTGGAGCGAGCCGG
CCACGGCGGGTGGAGCTGCCGACCTATGCCTTCCAGCGCCGCACCCACTGGGCACCGGGG
CTGACGCCGAATCATGCGCCTGCCGATCGTCCCGCGGCTGAGCCTCAGCGTGCGATGGCG
GTGGGTCCGGTGTCGCGCGAGGCTCTGGTCCGGCTCGTCGGCGAGACCACCGCGAGCGTC
CTGGGGCTCGACGGTCCCGACGAGGTAGCCCTGGACCGGCCGTTCACCTCACAGGGCCTC
GACTCGATGACGGCGGTGGAACTGGCCGGTCTGCTCGGTACGGCCGCCGGAGTCGCGCTC
GATCCGACCCTCGTCTACGAGCTGCCGACGCCACGGGCGGTGGCCGACCACCTGGCGAAG
ACCCTGCTCGGTGAGTCCGCTGCCGATGCCGACCAGGAGGTGAACGGCCGGACGGGGGAG
GCGGAGGCGAAGGCGGGTGATCCGATCGCCGTCATCGGTATCGGATGCCGGTTCCCGGGC
GGCGTGGCCACGCCCGACGACCTGTGGGAGCTGGTGGCCTCCGGGACCGACGCCATCTCC
ACCTTCCCGACCGACCGCGGCTGGGACCTGGACGGCCTGTACGACCCCGACCCCAGCACG
CCCGGCAAGAGCTACGTCCGCCACGGCGGCTTCCTCCACGACGCGGCCCAGTTCGACGCC
GAGTTCTTCGGCATCAGCCCCCGCGAAGCCACCGCCATGGACCCCCAGCAACGCCTCCTG
CTCGAAACCTCCTGGGAGGCGTTGGAGCGCGCCGGGGTCGTGCCGGAGTCTCTGCGTGGC
GGGCGGACCGGTGTGTTCGTCGGCACGACCGCACCGGAGTACGGGCCACGGCTGCACGAA
GGAACAGACGGATACGAGGGGTTCCTGCTCACCGGCACCACGGCCAGCGTGGCCTCAGGC
AGGATCGCCTACGCCCTGGGGACGCGCGGGCCGGCGCTCACCGTGGACACCGCGTGCTCC
TCCTCGCTGGTGGCGCTGCACCTGGCCGTGCAGTCGCTGCGGCGTGGGGAATGCGACCTC
GCCCTCGCCGGCGGAACCACCGTCATGTCCGGACCCGGCATGTTCGTGGAATTCTCGCGC
CAGCGGGGACTGGCGCCGGACGGCCGCTGCAAGGCCTTCTCGGCCGATGCCGACGGAACT
GCGTGGGCCGAGGGCGTCGGCATGCTCCTGGTCGAGCGACTCTCCGACGCCGAACGGCTA
GGCCACCGCGTGCTGGCCGTCGTGCGCGGCACCGCCGTCAACCAGGACGGCGCCAGCAAC
GGCCTCACCGCCCCCAGCGGACCCGCCCAACAACAAGTCATCCGCGACGCCCTGAGCGAC
GCGGGCCTCTCCGCCGACGACATCGACGCCGTCGAGGCCCACGGCACGGGCACGGCCCTC
GGCGACCCCATCGAAGCCGGCGCCCTGCTGGCCACCTACGGACACCCCAAGCGTCAGACA
CCGGTCTGGCTCGGATCGCTGAAGTCCAACATCGGCCACACCCAGGCCGCCGCCGGCATC
GCCGGAATCATCAAGATGGTGCAGGCGCTGCGGCACGACACCCTGCCGCGCACCCTCCAC
GCCGACCATCCCAGCAGCAAGGTCGACTGGGACGCCGGCCCGCTTCAGCTCCTGACCGAC
GCCCGGCCCTGGCCCGCCGACCCCGACCGGCCGCGCCGCGCCGGTATCTCCGCCTTCGGC
GTCAGCGGCACCAACGCCCACGTCGTGCTCGAAGAACCACCGGCACCGGAGGAAGCGCCC
GCGCGAACTCAAGCACCGCCGCCCGTGATCGCCTGGCCGTTGTCCGCGCACACCCCCACC
GCCCTGCGCGCCCAGGCCGCCCGCCTGGACTCATGGCTCCACCACACCCAGGCCGACCCC
CAGGACATCGCCCACGCCCTGGCCACCACACGCACCCACTTCAAACACCGCGCCGTCATC
ACCGGCCGCACCAGAACCGAACTCCACACCAAACTCCACACCCTCGACGCCATCCAAGGC
ACCGCACACCCCCACCCCCGCCTCACCCTGCTCTTCACCGGCCAAGGAGCCCAGCACCGC
GGCATGGGCCAAGAGCTCTACGCCACAGACCCGCACTTCGCCGCCGCCCTGGACGAAGTC
TGCGAAGAACTACAGCGCTGCGGCACCCAGAACCTGCGCGAGGTGATGTTCACCCCCGAC
CAGCCGGACCTGCTGGACCGCACCGAATACACCCAGCCCGCACTCTTCGCCCTGCAAACC
GCCCTCTACCGCACCCTGACAGCCCGCGGCACACAAGCCCACCTCGTCCTGGGCCACTCC
GTCGGCGAAATCACCGCAGCCCACATCGCCGGCGTCCTCGACCTGCCCGACGCCGCACGC
CTGATCACCGCACGCGCACACCTCATGGGACAACTCCCCCACGGCGGCGCCATGCTCTCC
GTCCAAGCCGCAGAACACGACCTCGACCAACTCGCACACACCCACGGCGTCGAGATCGCC
GCCGTCAACGGACCCACCCACTGCGTCCTGTCCGGACCCCGCACCGCCCTGGAAGAAACC
GCCCAGCAACTACACCAACAGGGCATACGCCACACCTGGCTGAAGGTCTCCCACGCCTTC
CACTCCGCCCTCATGGACCCCATGCTCGGCGCCTTCCGCGACACCCTCAACACCCTCAAC
TACCAACCCCCCACCATCCCCCTCATCTCCAACCTCACCGGCCAGATCGCCGACCCCAAC
CACCTCTGCACCCCCGACTACTGGATCGACCACGCACGCCACACCGTCCGCTTCGCCGAC
GCCGTCCAGACCGCCCACGACCAACGCACCACCACCTACCTCGAAATCGGGGCCCACCCC
ACCCTCACCACCCTCCTCCACCACACCCTCGACAACCCCACCACCATCCCCACCCTCCAC
CGCGAACACCCCGAACCAGAAACCCTCACCACCGCCCTCGCCACCCTCCACACCACCGGC
CACACCACCACCCTCCACACCACCAGCCCCCAAACCCACCACCTCGACCTGCCCACCTAC
CCCTTCCAACGCGACCGCTACTGGATGGAGCCGGTCAGGGTCGCCCAGGTCAGTGGTCAG
CCGGGGGCCGATCGGCTGCGTTATCGCGTCGTCTGGGAGGCCGCGCCCGAGGACCACACC
GTGCCCTCGGCGGAGCGCTGGCTGCTCCTCGGCGGGAGCGATCCGGCGGATGCCGGAATC
CTCGTCGGCGTCGAAGAGCAACTCGTCGGCCATGGGGCTGCCGTCCAGCGTCTCGACATA
CCGGCGCCCGCCGGGCGGAGGCTGTTGCCGAGCTGCTCCGAGCTGCCTGTGAGGGGGCCG
AGCCATACGGGCGAGTTCTGTGGCTCGCGCCTGCGGAGCCCTCGTGTTGCCGAGGCCGTG
GCTCTGCTCCAGGCACTGGGCGACGCCGGAGCGGACGCTCCTTTGTGGATCGCCACTCGC
GGTGCGGTGGCGGCGCAGGCCGGTGAGGCACCGTCCGTCGGGGGAGCACAGCTGTGGGGT
CTGGGCCAGGTCGCCGGTCTGGAACTCGCCGACCGCTGGGGCGGACTGGTGGACCTGCCC
GCCGATCCCGCTCCGGCCGCGCTGCGTGGGCTCGCCCGGGTGCTCGTCTCGAACGCCCCG
GACAACCAGGTGGCCATACGGGCCTCTGGTGTCTTCGTCCGTCGTGTGGTTCCCGCACCC
GGCCGGCCCGTGCGGAACGACTGGGCCCCTTCCGGGACCGTGCTCATCACCGGCGGCACG
GGGGCGCTGGGCTCTCAGGTCGCGCGCAGGCTCGCCCTGGCCGGAGCGCCGCATCTGCTG
CTGGCCGGACGTCGTGGGAACAGTGGTGCGGCCGAGCTGGTGGACGAGCTCACCGCGCTC
GGCGCCGAGGTCACCGTCGCGGCCTGTGACGCCGCCGACCGCGACGCACTCGTCTCGCTG
CTCGCCACGATCCCGGAGCACCGCCCGCTGACGGCTGTGCTGCACGCGGCCGGGGTGCTC
GACGACGGAGTGCTCGACGGACTCACCCCCGAGCGCATCGACGCGGTGCTGCGGGCCAAG
GCCACCGCCGCCCGCCACCTGGACGAACTGACCGCCGATCTCGATCTGGACGCCTTCGTG
CTCTTCTCCTCGATCGTCGGGGTGTGGGGCAATGGCGGGCAGGCCACGTACGCGGCGGCG
AACGCGGCCCTCGACGCGCTCGCCCATGGGCGGCGGGCGCGGGGACAGCGCGCCACGTCG
ATCGCCTGGGGCCCGTGGGCCGGTTCCGGGATGGCGGCCGGCGACGGGGCGAAGTCCTTG
GCACGGGACGGCATAGACGTACTGGAGCCGGAAGAGGCACTCGACCTGCTGGAGCAGGCG
GTCCGCTCCGACGAGACCACCCTGCTCGTCGCCGACGTGGACTGGGAGACATTCCTGTCG
TCTTCGGCGTCCCGCCGCTTCCAGCTGCCGCTGTTCGGCAGGATCCCGGCGGCACGTGCG
GTCGCCGTATCCGGTGCCGACGGCTCACCGGACGACGTACCCGTCTGGTTGTCGCCGCAG
CTCTCGGCGGCCGAGCGGCAGCTCCGTCTGCTGGATCTGGTGCGTACGGAGGCCGCCTCG
GTGCTTCGGCACGGCTCGGCCACGGCCGTCGACGCGGAAACGGCGTTCCGGGCAGGCGGG
TTCGACTCCCTCACCCTCGTGGAACTGCGCAACCGGCTGGCCTCCGCCACGGGGCTGCGC
CTGAGCAATACCCTGTTGTTCGACCATCCGACTCCGGCCGCTGTGGCCGAGTACCTGGGC
GAGCAGTTGCTCGGGACCGAGCCGTCCGCGGCGGCGAGCCACGGGGACGCCGGCGCTCGG
ACCGTCGTCGCATCGGACGAGCCGGTCGCGGTGGTGGGCATGGCCTGCCGCTACCCGGGC
GGCGTGGCCACGCCCGACGACCTGTGGGAGCTGGTGGCCTCCGGGACCGATGCCATCTCC
ACCTTCCCGACCGACCGCGGCTGGGACCTGGACGGCCTGTACGACCCCGACCCCAGCACG
CCCGGCAAGAGCTACGTCCGCCACGGCGGCTTCCTCCACGACGCGGCCCAGTTCGACGCC
GAGTTCTTCGGCATCAGCCCCCGCGAAGCCACCGCCATGGACCCCCAGCAACGCCTCCTG
CTCGAAACCTCCTGGGAAGCCCTCGAACACGCCGGGATCGCCCCCCACACCCTGCGCACC
ACCCGCACCGGCGTCTTCACCGGGGCTTCCCAACAGGAATACGGAACCCAGTCGCGCGAG
GCCGCCGACAAGTACGGCGGTCATCTCCTCACCGGCACGCTGGCAAGCGTCATGTCGGGC
CGGGTGGCGTACACGCTGGGCCTGCAGGGACCCGCGCTCACCGTGGACACCGCGTGCTCG
TCGTCGCTGGTGGCGCTGCACCTGGCCGTGCAGTCGCTGCGGCGCGGGGAATGCGACCTC
GCCCTCGCCGGCGGGAGCACCGTCATGTCCACTCCCACCGTCTTCGTCGAGTTCTCCCGC
CAGCGCGGGCTGGCGCCGGACGGCCGCTGCAAACCCTTCGCCGACACCGCCGACGGCACC
GCGTGGGCCGAGGGCGTCGGGGTACTGCTGGTGGAGCGGTTGTCGGACGCCGAACGGCTC
GGCCACCGTGTGCTGGCCGTCGTGCGCGGCACCGCCGTCAACCAGGACGGCGCCAGCAAC
GGTCTCACCGCCCCCAGCGGACCCGCCCAACAACAAGTCATCCGCGACGCCCTGAGCGAC
GCGGGTCTCTCCGCCGACGACATCGACGCCGTCGAGGCCCACGGGACCGGCACGCCCCTC
GGTGACCCCATCGAAGCCGAGGCCTTGCTGGCCACCTATGGACACCCCGAGCGTCAGACG
CCGGTCTGGCTGGGGTCGTTGAAGTCCAACATCGGCCACAGCCAGGCCGCCGCCGGCATC
GCCGGAATCATCAAAATGATCCAAGCCATGCACCACGGCACCCTGCCGCGCACCCTGCAT
GTGGATGCGCCCACATCCCAGGTCGACTGGGAGGCCGGTTCCCTCCAACTCCTCGCAGAG
GCCCGGCCCTGGCCCGCCGACCCCGACCGGCCGCGCCGCGCCGGTATCTCCGCCTTCGGC
GTCAGCGGCACCAACGCCCACGTCGTGCTCGAAGAACCACCGGCACCGGAGGAAGCGCCC
GCGCGAACTCAAGCACCGCCGCCCGTGATCGCCTGGCCGTTGTCCGCGCACACCCCCACC
GCCCTGCGCGCCCAGGCCGCCCGCCTGGACTCATGGCTCCACCACACCCAGGCCGACCCC
CAGGACATCGCCCACGCCCTGGCCACTACCTGCACCCACTTCAAACACCGCGCCGTCATC
ACCGGCCGCACCAGAACCGAACTCCACACCAAACTCCACACCCTCGACGCCATCCAAGGC
ACCGCACACCCCCACCCCCGCCTCACCCTGCTCTTCACCGGCCAAGGAGCCCAGCACCCC
GGCATGGGCCAGGAGCTCTACACCACAGACCCGCACTTCGCCGCCGCCCTGGACGAAATC
TGCGAAGAACTACAACGCTGCGGCACCCAGAACCTGCGCGAAGTGATGTTCACCCCCGAC
CAGCCGGACCTGCTGGACCGCACCGAATACACCCAGCCCGCCCTCTTCGCCCTGCAAACC
GCCCTCTACCGCACCCTGACAGCACACGGCACACAAGCCCACCTCGTCCTGGGCCACTCC
GTCGGCGAAATCACCGCAGCCCACATCGCCGGCGTCCTCGACCTGCCCGACGCCGCACGC
CTGATCACCGCACGCGCACACCTCATGGGACAACTCCCCCACGACGGCGCCATGCTCTCC
GTCCAAGCCGCAGAACACGACCTCGACCAACTCGCACACACCCACGGCGTCGAGATCGCC
GCCGTCAACGGACCCACCCACTGCGTCCTGTCCGGACCCCGCACCGCCCTGGAAGAAACC
GCCCAGCACCTACGCGAGCAAAACGTGCGCCACACGTGGCTGAAGGTCTCCCACGCCTTC
CACTCCGCCCTCATGGACCCCATGCTCGGCGCCTTCCGCGACACCCTCAACACCCTCAAC
TACCAACCCCCCACCATCCCCCTCATCTCCAACCTCACCGGCCAGATCGCCGACCCCAAC
CACCTCTGCACCCCCGACTACTGGATCGACCACGCACGCCACACCGTCCGCTTCGCCGAC
GCCGTCCAGACCGCCCACGACCAACGCACCACCACCTACCTGGAAATCGGCCCCCACCCC
ACCCTCACCACCCTCCTCCACCACACCCTCGACAACCCCACCACCATCCCCACCCTCCAC
CGCGAACACCCCGAACCAGAAACCCTCACCACCGCCCTCGCCACCCTCCACACCACCGGG
CACACCACCACCCCCCATCCCTCGCACATCCCCGCTCAGCGGGTGTCGCTGCCGGCCTAC
CCCTTCCAACGCCGCGCCTACTGGATGCCGAACTCGGCTGCGCACATCGGGCGTTCGGAT
GCCGAGGCGGCTACCCGCCTGGGCCTGGCCCGGCAGGACCATCCGTTCCTGACCGGCGCC
ACGTCGATCGTCGGCAGCGGGGCGACTCTGCTCACCGGCAGGGTGTCGCTCGCGGCGCAC
CCATGGCTGGCCGATCACACGGTCGCCGGGGCGGTGCTGTTCCCCGGAACGGCCTTCGCC
GACCTGCTGCTGCACGTTGCCGAGGAGACGGGGTCGGGGACCGTGGAAGAACTCACTCTC
CATGTGCCCCTCGTTCTTCCCGCGCAGGGCGCTGTGCAGCTTCAGGTGCTGGTGGAAGCA
CCGGACGAGCGCGGGCGGCGCGCGGCGACGGTGGCTGCCCGGCCGGAGGAGGAGACCGGG
GCGGAGTGGACCACGCACGCAGCCGGTGTTCTGGCGGGCGCGGAACCGGCCGCGCCGGCG
GTGGACTGGGCGGACTGGGCGGCAGGGGCCTGGCCACCGCCCGGGGCGGAAGCCGTCGAC
GTGGACGAGCTGTACGCGGAGTTCGCCGCCGCCGGCTACGACTACGGTCCGGCCTTCACC
GGCCTGACCGGTGCGTGGCGCCGTGGGGAGGAGGTCTTCGCCGACGTGCGCCTGCCCGAG
GCGGTGGCCGGGTCAGGGGAGGAGGAGCGCCGGTTCGGTGTGCATCCCGCGTTGTTCGAC
GCGGCCCTGCACCCGTGGCGGGTGGGAGGCCCGTGGCAGGAGTCCGGCCCCGATGCGGAT
GGTGGGCAGAGCACCCTGCTGCCGTTCTCCTGGCAGGGGCTCACCCTGTACGGGACCGGC
GCAGAGCAGGTCCGGGTCCGGCTGGCACCGTCGGACGGTGGCGCCTTCTCCGTGCGGGCC
GCCGACCCGGCGGGCCACCCCGTCCTCGCCCTGGACGCGCTCGTACTGCGTCGAGTGCCG
TCGAGCACTCCGGGCGCCCTTCCGGCGGCGCCGATGTACCACATCGACTGGCAGCCGGTC
GACTCGACCAGCCTCGTGGACACTCGCCGCTACGCCGTGGTCGGCGCCGATGCGGATGAG
ACAGCGGAGGTTCTGCGCGCCTTCCTGCCGGATGCGCACACCACGGCCCACGCCGACCTC
GCGGCCCTGCGGGCCGCTCCGGACGCCGTGGCACCGACGCCCGGCCCCGCCCTTGTCGTT
GCGCTCATCCCCGGCTCCCCTCCCCCGGCGCCCGAGGCCACGTCCGCGCCCGACCCCGTC
CGTGCGACCCTCGCCCACGGTCTCTCGCTCGTCCAGGCACTGATCGAGGACGAACGCCTG
ACCACCGGCACGACACTGGCCGTCGTCACCCGGGGCGCGGTCGAGGCCACGCAGACCGAC
GTGCCGGATCTCGCGGGCGCCGCGCTGTGGGGGTTGGTGCGCTCCGCGCAGTCGGAGTAT
CCGGGCCGCTTCCGCCTCATCGACGTGGACGACTCCCCGGAGTCCCGAGCGGCCCTGGCG
ACGGCGCTGGCCTCGGACGAGCCCCAGCTCGCGTTGCGGGCGGGCGTCATGCTCGCGCCG
GCGCTGACACCCGCGGAGGCCGCCGGGTCGCCGGCTCCGGCGGACGCCGCACCCACCGCC
CACGGCATGGACGGCACCGTCCTGCTGACCGGCTGCACCGGTGCGCTCGGCCGACGCGTC
GCCGTGCACCTGGCGAGGCGTCACGGTGTACGGCGGATGCTGCTGGTCAGCAGGAGCGGT
CCGAACGCGCCGGAGTCCGCCGCGCTGGAACGGGAACTCACCGAGCTGGGCGTCCACACC
TCCTTCGTCTCCTGCGACCTGGCCGATCCGGCCGACGTACGGAAGGCGGTCGCCGGAGTC
CCGTCCGACCATCCGCTGACCGGTGTCGTGCACACCGCCGGTGTCCTCGACGACGGGGCG
CTCGCCCGGCTGACTCCGGAGCGGATCGACACCGTGCTGCGGGCCAAGGCCGACGCCGTA
CGCCACCTCCACGAGGCGACGCTCGGGCATCCATTGCGCGCCTTCGTGCTGTTCTCCGCC
GCGGCCGGGTTACTGGGCCGTCCGGGGCAAGCGTCCTACGCGGCCGCCAACGCTGTGCTC
GACGCGTTCGCGCGGCTTCGCCGGGCGGAGGGGCTGCCGGCGGTCTCCCTGGCCTGGGGG
CTGTGGGACGAACGGGAGGGCATGGCCGGCGGCCTCGATGCCACGGCCCTTCGCCGACTT
CGCCGGGACGGCATCCTGCCGATGCCCGCCGACCAGGCCCTCGAACTGCTGGACCAGGCC
CTGACGACGTACCGGGACGGGCCCGCACTGCTCGTCCCGCTGCTGCTGGACAGCACGGCG
CTGCGCCGCACGGCCGGGGAGAACGGCCCAGCCTCGGTCCCGCCGTTGCTGCGCTCCCTC
GTCCCCTCCCACCCGCGCCGGCATCGCACGACCACGGCGACGTCCGTTCGGGACGAATCC
GGGCCGGGTCCGTCGGCACGTCTCGCGGCGCTGCCCGCCAAGGAGCGCATGACCGTCCTG
CTGGACACGGTCAGCGAACAGGTCGCCGGTGTCCTCGGCCACGCGTCGGCCGCGGAGATC
GATCCCGAACGGCCTTTCCACGAGATCGGCTTCGACTCCCTGGCCACGCTGGAGCTGCGC
AACCGGCTCGGCCGCCTGGTCGGTCTGCGTCTGCCGAGCACGCTCGCCTTCGACCATCCC
ACGCCGAGGAAGGTGGCGGAATGGATCAACGCGGAACTGCCCGCCGCGAACCCCGCTTTG
GGCACGTCGGCCGAGGATCCCGTGCTGACGGGGATCGACCAGATGGCTCGAGCGATCGCC
CTCATGGACGCGGAGGACGGCCGACGCGCCGATGTGCGCCAACGACTCGTCGGTCTGCTG
ACCGCTCTGGACAGGCCGGCGTCCGGTGCGGACAGCACCCGAGCCGCCGCGACGACCGTG
GCGGACCGACTCGACGAGGCAACCGACGACGAGATCTTCGCGTTCCTCGACGAACAGCTG
GAGGAGCAACCGGACGAGCCGTTGGGCGCACCTCTGGACGAGCGCCTGGACGAGCAACCG
TGA
[0] KSQ24..377
[0] AT538..845
[0] malonyl-CoA725..729
[0] ACP905..979
[1] KS1007..1381
[1] AT1530..1841
[1] malonyl-CoA1718..1722
[1] KR2092..2269
[1] ACP2370..2440
[2] KS2466..2842
[2] AT2990..3301
[2] malonyl-CoA3178..3182
[2] DH3354..3522
[2] KR3865..4045
[2] ACP4160..4230
[0] KSQ70..1131
[0] AT1612..2535
[0] malonyl-CoA2173..2187
[0] ACP2713..2937
[1] KS3019..4143
[1] AT4588..5523
[1] malonyl-CoA5152..5166
[1] KR6274..6807
[1] ACP7108..7320
[2] KS7396..8526
[2] AT8968..9903
[2] malonyl-CoA9532..9546
[2] DH10060..10566
[2] KR11593..12135
[2] ACP12478..12690

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [531-659]  G3DSA:3.40.366.10 [725-839]  G3DSA:3.40.366.10 [1519-1652]  G3DSA:3.40.366.10 [1718-1832]  G3DSA:3.40.366.10 [2979-3112]  G3DSA:3.40.366.10 [3178-3292]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [3865-4032]  9.09999999999992e-56 PF00106
PF00106   adh_short
IPR006162 Phosphopantetheine attachment site (PTM)
 [4188-4203]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [902-1023]  4.70000326671387e-22 SSF47336 [2363-2483]  4.30000170645867e-24 SSF47336 [4152-4247]  7.89999609889417e-24 SSF47336
SSF47336   ACP_like
 [905-979]  PS50075 [2370-2440]  PS50075 [4160-4230]  PS50075
PS50075   ACP_DOMAIN
 [906-982]  1.99999999999999e-60 G3DSA:1.10.1200.10 [2369-2443]  1.99999999999999e-60 G3DSA:1.10.1200.10 [4158-4234]  1.99999999999999e-60 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [917-978]  1.6e-10 PF00550 [2373-2439]  3.4e-10 PF00550 [4163-4229]  2.6e-10 PF00550
PF00550   PP-binding
IPR013968 Polyketide synthase, KR (Domain)
 [2092-2268]  3.60000000000002e-61 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [24-251]  1.99999999999999e-74 PF00109 [1007-1257]  7.79999999999999e-100 PF00109 [2466-2717]  5.90000000000008e-102 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [259-377]  1.6e-38 PF02801 [1265-1381]  5.00000000000001e-46 PF02801 [2725-2842]  8.60000000000004e-48 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [538-845]  8.49999999999995e-65 PF00698 [1530-1841]  2.39999999999997e-68 PF00698 [2990-3301]  1.79999999999997e-68 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [534-824]  5.39997012872478e-68 SSF52151 [1527-1817]  6.90004508941104e-66 SSF52151 [2987-3277]  4.50001022902825e-67 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [661-724]  7.70000171387738e-16 SSF55048 [1654-1717]  1.09999909120787e-15 SSF55048 [3114-3177]  7.99999145876753e-16 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [23-262]  G3DSA:3.40.47.10 [263-430]  G3DSA:3.40.47.10 [1009-1269]  G3DSA:3.40.47.10 [1270-1435]  G3DSA:3.40.47.10 [2469-2729]  G3DSA:3.40.47.10 [2730-2895]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [15-431]  1.09999184471405e-80 SSF53901 [999-1435]  5.10003242202156e-104 SSF53901 [2459-2840]  1.19999063421924e-106 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [2092-2302]  3.60000000000002e-74 G3DSA:3.40.50.720 [3865-4075]  3.60000000000002e-74 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [1170-1186]  PS00606 [2630-2646]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [538-830]  2.1000026783403e-118 SM00827 [1531-1823]  1.59998835313644e-116 SM00827 [2991-3283]  1.09999184471405e-117 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [910-982]  3.00000067992871e-22 SM00823 [2371-2443]  6.19998763505952e-29 SM00823 [4161-4233]  3.49999466863949e-29 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [3354-3522]  1.59998835313644e-71 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [25-431]  SM00825 [1009-1435]  SM00825 [2469-2895]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [2092-2269]  3.99998544139406e-59 SM00822 [3865-4045]  5.59999989417026e-53 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit