close all open/close all

CDS information : Nidda_00030


close this sectionLocation

Organism
StrainNRRL 2821
Entry nameNiddamycin
Contig
Start / Stop / Direction13,693 / 19,212 / + [in whole cluster]
13,693 / 19,212 / + [in contig]
Location13693..19212 [in whole cluster]
13693..19212 [in contig]
TypeCDS
Length5,520 bp (1,839 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)polyketide synthase module 3
Gene
Gene (GenBank)nidA2
EC number
Keyword
Note
Note (GenBank)
  • orf2
Reference
ACC
PmId
[9393718] Identification and characterization of the niddamycin polyketide synthase genes from Streptomyces caelestis. (J Bacteriol. , 1997)

close this sectionPKS/NRPS Module

3 malonyl-CoA
KS35..410
AT563..874
DH923..1089
KR1383..1564
ACP1674..1744

close this sectionSequence

selected fasta
>polyketide synthase [polyketide synthase module 3]
MTAENDKIRSYLKRATAELHRTKERLAELESARHEPVAVVGMACRYPGGVATPDDLWELV
ASGTDAISTFPTDRGWDLDGLYDPDPSTPGKSYVRHGGFLHDAAQFDAEFFGISPREATA
MDPQQRLLLETSWEALEHAGIAPNTLRTTRTGVFTGVMYDDYGSRCFPSLPEVEGYVVNG
SAGSVASGRVAYTLGLQGPALTVDTACSSSLVALHLAVQSLRRGECDLALAGGSTVMSTP
TVFVEFSRQRGLAPDGRCKSFADTADGTAWAEGVGVLLVERLSDAERLGHRVLAVVRGTA
VNQDGASNGLTAPSGPAQQQVIRDALSDAGLSADDIDAVEAHGTGTPLGDPIEAGALLAT
YGHPERQTPVWLGSLKSNIGHTQAAAGIAGIIKMIQAMHHGTLPRTLHVDHPSSKVDWKA
GSLQLLAQARPWPADPDRPRRAAVSAFGVSGTNAHAIIEEPSTLIEAPVPDETPVPAHTP
PVIAWPLSAHTPTALRAQAARLDSWLHHTQADPQDIAHALATTRTHFKHRAVITGRTRTE
LHTKLHTLDAIQGTAHPHPRLTLLFTGQGAQHPGMGQELYTTDPHFAAALDEVCEELQRC
GTQNLREVMFTPDQPDLLDRTEYTQPALFALQTALYRTLTARGTQAHLVLGHSVGEITAA
HIAGVLDLPDAARLITARAHLMGQLPHGGAMLSVQAAEHDLDQLAHTHGVEIAAVNGPTH
CVLSGPRTALEETAQHLREQNVRHTWLKVSHAFHSALMDPMLGAFRDTLNTLNYQPPTIP
LISNLTGQIADPNHLCTPDYWIDHARHTVRFADAVQTAHHQGTTTYLEIGPHPTLTTLLH
HTLDNPTTIPTLHREHPEPETLTTALATLHTTGHTTTLHTTSPQSHHLDLPTYPFQRDRY
WMAVPPRAAVGDLAAAGVTAVGHPLLAAVTEVPETDTTVWTGMLSARALPWLADHLVWDR
GVAPGTAVLEIVLEIGERIGLPCIGELVLEAPLSWGADAPAVVRTVVGALSPEGTREVSL
YSRPEDEAVWTRHASGRLARAGSEEMGSGVFAELSGVWPPPGAQEVDISGQYELFAAAGV
GYGGAFRGLRAVWRREDEIFAEVRLPDDHATDAAGYGLHPALLDAALHPIALLDPLGDGG
HGLLPFVWTDVLRPGNGGHTLRVRVTRAQDPADGGQDDRPGGAVSLAAADRDGVPVFVAR
SLVLRRVSATQLPAAPFVPLHRLDWVPIPGFTESTGAGGSDPSVLDLTELTADVHLTVRE
VLEAVQAHLREPVGDGGRLVVLTRGAAGPEGGADAPAGAAAWGLVRSAQSEHPGRFVLID
VDGTEESSRALPAVMAAVGDVDAPQVAVRQGRPSVPRLVPLTADRTEAEPGGPGSAGLLG
PDGTVLITGGTGALAAVTARHLVARHGARHLLLVSRRGTDAPQAAELASELGALGADVEF
RACDVTDRAAVQRLLAGIPAEHPLSCVVHTAGVLDDGVISAQTPERVAAVLGPKADGALH
LDELTRDRERSVPLVLFSSVSGVLGSTGHAGYAAANAFLDALAARRRADGHPALSLGWGW
WTGTGMAAGLDRADTARIRRSGIAPLDAETAMDLFDRALARPEPALLPVRLDHAALREAA
RAGTLPEVLRDLAGVPSRAHPAPGSEGTATSTGTGSGLAERLARRTVAERLPLLLELVRT
EVAAVLGHGDPGAVGAERSFKDAGFDSLTAVDLRNRLNARTGLRLPATLVFDHPTPLALA
ELLLAGLDVEPAADGPEDLAAAFDRLARGLAALDDRAARVGAAERLRSLLTALTSADPAT
GTGAQAGPEADGALTEVVTDRLRSASDDELFDLYDSEFR
selected fasta
>polyketide synthase [polyketide synthase module 3]
ATGACCGCGGAGAACGACAAGATCCGCAGCTATCTGAAGCGCGCCACCGCCGAACTCCAC
CGGACCAAGGAGCGGTTGGCGGAGCTGGAGTCAGCGCGGCATGAGCCGGTCGCGGTGGTG
GGCATGGCATGCCGCTACCCCGGCGGCGTGGCCACGCCCGACGACCTGTGGGAGCTGGTG
GCCTCCGGAACCGACGCCATCTCCACCTTCCCGACCGACCGCGGCTGGGACCTGGACGGC
CTGTACGACCCCGACCCCAGCACGCCCGGCAAGAGCTACGTCCGCCACGGCGGCTTCCTC
CACGACGCGGCCCAGTTCGACGCCGAGTTCTTCGGCATCAGCCCCCGCGAAGCCACCGCC
ATGGACCCCCAGCAACGCCTCCTGCTCGAAACCTCCTGGGAAGCCCTCGAACACGCCGGG
ATCGCCCCCAACACCCTGCGCACCACCCGCACCGGCGTCTTCACCGGCGTCATGTACGAC
GACTACGGGTCGCGGTGTTTTCCGTCGCTCCCCGAAGTCGAGGGGTACGTCGTGAACGGC
AGCGCGGGGAGTGTGGCGTCGGGCCGGGTGGCGTACACGCTGGGCCTGCAGGGACCCGCG
CTCACGGTGGACACCGCGTGCTCGTCGTCGCTGGTGGCGCTGCACCTGGCCGTGCAGTCG
CTGCGGCGTGGGGAATGCGACCTCGCCCTCGCCGGTGGAAGCACCGTCATGTCCACCCCG
ACCGTCTTCGTCGAGTTCTCCCGCCAGCGCGGGCTGGCGCCGGATGGCCGTTGCAAATCC
TTCGCTGATACCGCCGACGGCACCGCGTGGGCCGAGGGCGTCGGGGTGCTCCTGGTCGAG
CGACTCTCCGACGCCGAGCGGCTAGGCCACCGCGTGCTGGCCGTCGTGCGCGGCACCGCC
GTCAACCAGGACGGCGCCAGTAACGGTCTCACCGCCCCCAGCGGACCCGCCCAACAACAA
GTCATCCGCGACGCCCTGAGCGACGCGGGCCTCTCCGCCGACGACATCGACGCCGTCGAG
GCCCACGGGACCGGCACCCCCCTCGGCGACCCCATCGAAGCCGGCGCCCTGCTGGCCACC
TACGGACACCCCGAGCGTCAGACACCGGTCTGGCTCGGATCGCTGAAGTCCAACATCGGC
CACACCCAGGCCGCCGCCGGCATCGCCGGAATCATCAAAATGATCCAAGCCATGCACCAC
GGCACCCTGCCGCGCACCCTGCATGTCGACCATCCCAGCAGCAAGGTCGACTGGAAGGCC
GGCTCCCTCCAACTCCTCGCTCAGGCCCGGCCCTGGCCCGCCGACCCCGACCGGCCACGC
CGCGCCGCCGTCTCCGCCTTCGGCGTCAGCGGCACCAACGCCCACGCCATCATCGAAGAA
CCATCCACCCTCATCGAGGCGCCAGTCCCCGACGAAACACCGGTGCCGGCTCATACCCCG
CCCGTGATCGCCTGGCCGTTGTCCGCCCACACCCCCACCGCCCTGCGCGCCCAGGCCGCC
CGCCTGGACTCATGGCTCCACCACACCCAGGCCGACCCCCAGGACATCGCCCACGCCCTG
GCCACCACCCGCACCCACTTCAAACACCGCGCCGTCATCACCGGCCGCACCAGAACCGAA
CTCCACACCAAACTCCACACCCTCGACGCCATCCAAGGCACCGCACACCCCCACCCCCGC
CTCACCCTGCTCTTCACCGGCCAAGGAGCCCAGCACCCCGGCATGGGCCAAGAGCTCTAC
ACCACAGACCCGCACTTCGCCGCCGCCCTGGACGAAGTCTGCGAAGAACTACAACGCTGC
GGCACCCAGAACCTGCGCGAGGTGATGTTCACCCCCGACCAGCCGGACCTGCTGGACCGC
ACCGAATACACCCAGCCCGCACTCTTCGCCCTGCAAACCGCCCTCTACCGCACCCTGACA
GCCCGCGGCACACAAGCCCACCTCGTCCTGGGCCACTCCGTCGGCGAAATCACCGCAGCC
CACATCGCCGGCGTCCTCGACCTGCCCGACGCCGCACGCCTGATCACCGCACGCGCACAC
CTCATGGGACAACTCCCCCACGGCGGCGCCATGCTCTCCGTCCAAGCCGCAGAACACGAC
CTCGACCAACTCGCACACACCCACGGCGTCGAGATCGCCGCCGTCAACGGACCCACCCAC
TGCGTCCTGTCCGGACCCCGCACCGCCCTGGAAGAAACCGCCCAGCACCTGCGCGAGCAA
AACGTGCGCCACACGTGGCTGAAGGTCTCCCACGCCTTCCACTCCGCCCTCATGGACCCC
ATGCTCGGCGCCTTCCGCGACACCCTCAACACCCTCAACTACCAACCCCCCACCATCCCC
CTCATCTCCAACCTCACCGGCCAGATCGCCGACCCCAACCACCTCTGCACCCCCGACTAC
TGGATCGACCACGCACGCCACACCGTCCGCTTCGCCGACGCCGTCCAGACCGCCCACCAC
CAAGGCACCACCACCTACCTGGAAATCGGCCCCCACCCCACCCTCACCACCCTGCTCCAC
CACACCCTCGACAACCCCACCACCATCCCCACCCTCCACCGCGAACACCCCGAACCAGAA
ACCCTCACCACCGCCCTCGCCACCCTCCACACCACCGGCCACACCACCACCCTCCACACC
ACCAGCCCCCAAAGCCACCACCTCGACCTGCCCACCTACCCCTTCCAACGCGACCGCTAC
TGGATGGCTGTTCCGCCTCGCGCCGCGGTCGGCGACTTGGCCGCGGCGGGCGTGACCGCT
GTGGGGCATCCGCTGCTCGCGGCAGTGACGGAAGTGCCGGAGACCGACACCACGGTGTGG
ACGGGCATGCTGTCCGCCCGTGCCCTGCCCTGGCTCGCCGACCATCTGGTGTGGGACCGG
GGCGTGGCGCCCGGCACCGCCGTGCTGGAGATCGTGCTGGAGATCGGGGAGCGGATCGGG
CTGCCCTGTATCGGTGAGCTGGTCCTGGAAGCGCCCCTGAGCTGGGGCGCCGACGCTCCG
GCGGTGGTCCGGACGGTCGTGGGCGCCCTGAGCCCTGAGGGCACGCGGGAGGTGAGTCTT
TACTCCCGGCCCGAGGACGAAGCCGTCTGGACTCGGCACGCGTCGGGTCGGCTCGCCCGG
GCCGGGTCGGAGGAGATGGGAAGCGGCGTCTTCGCGGAGCTCTCCGGCGTTTGGCCGCCT
CCCGGCGCACAGGAGGTCGACATCTCCGGCCAGTACGAGCTGTTCGCCGCCGCCGGGGTG
GGCTACGGGGGCGCGTTCCGTGGACTTCGGGCCGTGTGGCGCCGGGAGGACGAGATCTTC
GCCGAGGTACGGCTGCCCGACGACCATGCCACCGACGCCGCGGGCTACGGTCTGCATCCC
GCGCTGCTCGACGCGGCCCTGCATCCCATCGCGCTGCTCGACCCGCTGGGCGACGGCGGG
CACGGGCTTCTGCCGTTCGTGTGGACCGATGTGCTGCGTCCCGGGAACGGCGGGCACACC
CTGCGCGTACGCGTCACCAGGGCGCAGGACCCGGCGGACGGCGGGCAGGACGACCGTCCC
GGCGGCGCCGTCTCGCTGGCGGCGGCCGACCGCGACGGCGTCCCGGTGTTCGTCGCACGC
TCGCTGGTGCTGCGTCGTGTCTCCGCCACACAGTTGCCCGCCGCGCCGTTCGTTCCGCTC
CATCGCCTGGACTGGGTGCCGATTCCCGGCTTCACGGAATCGACCGGCGCCGGCGGCTCC
GACCCGTCCGTCCTGGACCTCACCGAACTCACCGCCGACGTCCACCTGACCGTCCGGGAG
GTGCTTGAGGCGGTCCAGGCGCACCTCCGGGAACCGGTCGGCGACGGCGGGCGGTTGGTT
GTCCTCACCCGGGGCGCGGCCGGTCCCGAAGGCGGTGCCGACGCCCCGGCGGGGGCGGCT
GCCTGGGGACTGGTCCGCAGTGCGCAGAGCGAGCATCCCGGCCGGTTCGTCCTGATCGAC
GTCGACGGTACGGAGGAGTCCTCGCGGGCGCTGCCCGCCGTCATGGCCGCCGTAGGGGAC
GTGGACGCCCCCCAGGTCGCGGTCCGTCAGGGCCGCCCGAGTGTGCCGCGCCTCGTACCG
CTGACCGCCGACAGGACCGAAGCGGAACCGGGCGGGCCGGGCTCCGCCGGGCTGCTCGGT
CCGGATGGCACGGTGCTGATCACCGGCGGGACGGGCGCCCTGGCCGCCGTGACCGCCCGG
CATCTGGTGGCCCGTCACGGCGCACGGCATCTGCTGCTGGTCTCCAGGCGTGGCACGGAC
GCGCCGCAAGCGGCCGAGTTGGCGTCGGAACTCGGCGCTCTGGGCGCCGACGTCGAGTTC
CGGGCCTGTGATGTCACCGACCGGGCGGCCGTCCAACGTCTGCTGGCCGGGATCCCCGCC
GAGCACCCTCTGAGCTGTGTGGTGCACACCGCGGGCGTTCTGGACGACGGGGTGATCTCC
GCGCAGACGCCGGAGCGTGTCGCCGCCGTACTGGGGCCCAAGGCGGACGGCGCACTCCAC
TTGGACGAGCTGACCCGGGACCGGGAACGGTCCGTTCCCCTGGTGCTGTTCTCCTCGGTC
TCGGGCGTCCTGGGTAGCACGGGCCATGCCGGTTACGCCGCCGCGAACGCCTTTCTGGAC
GCGCTCGCCGCGCGGCGCCGGGCGGACGGTCACCCCGCCCTGTCGCTCGGATGGGGCTGG
TGGACCGGCACGGGCATGGCCGCCGGGCTGGACCGGGCGGACACGGCGCGCATCCGGCGT
TCCGGCATCGCCCCGCTCGACGCGGAAACGGCGATGGACCTGTTCGACCGGGCGTTGGCC
CGGCCGGAACCCGCGCTGCTGCCGGTGCGGCTGGACCACGCCGCGCTGCGCGAGGCGGCC
CGGGCCGGCACGCTGCCGGAGGTTCTGCGGGATCTCGCCGGTGTCCCGTCCCGCGCTCAC
CCCGCACCGGGGAGCGAAGGCACCGCGACGTCCACCGGGACCGGCAGCGGCCTCGCCGAG
CGGCTGGCGCGCCGCACGGTCGCCGAGCGCCTGCCCCTGCTGCTCGAACTCGTACGGACC
GAGGTCGCCGCGGTACTGGGGCATGGCGACCCCGGTGCGGTGGGTGCCGAACGCTCCTTC
AAGGACGCCGGGTTCGACTCGCTCACCGCCGTGGATCTGCGCAACCGGCTCAACGCGCGT
ACGGGACTGCGACTGCCGGCGACCCTCGTCTTCGACCATCCGACGCCGCTGGCGCTGGCC
GAACTCCTGCTCGCCGGCCTGGACGTGGAACCGGCCGCCGACGGCCCGGAGGACCTGGCC
GCCGCGTTCGACCGGCTCGCGCGCGGCCTCGCGGCCCTGGACGACCGTGCCGCTCGCGTC
GGCGCGGCCGAGCGGCTGCGCTCCCTGCTCACCGCTCTCACCAGCGCTGATCCGGCCACG
GGCACGGGGGCGCAGGCGGGCCCGGAAGCGGACGGCGCGCTCACCGAGGTGGTCACCGAC
CGGTTGAGGTCGGCCTCGGACGACGAGCTCTTCGACCTGTACGACAGCGAGTTCCGGTGA
[3] KS35..410
[3] AT563..874
[3] malonyl-CoA751..755
[3] DH923..1089
[3] KR1383..1564
[3] ACP1674..1744
[3] KS103..1230
[3] AT1687..2622
[3] malonyl-CoA2251..2265
[3] DH2767..3267
[3] KR4147..4692
[3] ACP5020..5232

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [552-685]  1.60000000000002e-75 G3DSA:3.40.366.10 [751-865]  1.60000000000002e-75 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [1383-1550]  6.90000000000001e-58 PF00106
PF00106   adh_short
IPR006162 Phosphopantetheine attachment site (PTM)
 [1702-1717]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1674-1744]  PS50075
PS50075   ACP_DOMAIN
 [1674-1745]  2.90000000000001e-21 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1677-1743]  2.3e-12 PF00550
PF00550   PP-binding
 [1666-1747]  3.49999466863949e-22 SSF47336
SSF47336   ACP_like
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [35-285]  2.39999999999997e-101 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [293-410]  9.9e-48 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [563-874]  2.70000000000002e-68 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [3-28]  1.8e-09 PF08990
PF08990   Docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [560-850]  6.19996040581186e-68 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [687-750]  7.70000171387738e-16 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [35-296]  2.30000000000004e-92 G3DSA:3.40.47.10 [297-461]  2.70000000000002e-65 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [27-408]  1.90000694315261e-106 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1383-1566]  2.80000000000001e-36 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [198-214]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [564-856]  2.19999900980707e-119 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1675-1747]  2.99998750445706e-35 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [923-1089]  5.00000909915354e-57 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [37-463]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1383-1564]  9.60004130884281e-53 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit