close all open/close all

CDS information : Nidda_00040


close this sectionLocation

Organism
StrainNRRL 2821
Entry nameNiddamycin
Contig
Start / Stop / Direction19,269 / 30,233 / + [in whole cluster]
19,269 / 30,233 / + [in contig]
Location19269..30233 [in whole cluster]
19269..30233 [in contig]
TypeCDS
Length10,965 bp (3,654 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)polyketide synthase modules 4 and 5
Gene
Gene (GenBank)nidA3
EC number
Keyword
Note
Note (GenBank)
  • orf3
Reference
ACC
PmId
[9393718] Identification and characterization of the niddamycin polyketide synthase genes from Streptomyces caelestis. (J Bacteriol. , 1997)

close this sectionPKS/NRPS Module

4 methylmalonyl-CoA
5 ethylmalonyl-CoA
KS36..410
AT569..892
kr1088..1260
ACP1364..1434
KS1460..1838
AT2008..2328
DH2374..2536
ER2877..3182
KR3192..3372
ACP3483..3553

close this sectionSequence

selected fasta
>polyketide synthase [polyketide synthase modules 4 and 5]
MSATNEEKLREYLRRAMGDLHSARERLAELESARHEPVAVVGMACRYPGGVATPDDLWEL
VASGTDAISTFPTDRGWDLDGLYDPDPSTPGKSYVRHGGFLHDAAQFDAEFFGISPREAT
AMDPQQRLLLETSWEALEHAGIAPHTLRTTRTGVFTGVMHHDYGSHQVGSAADASGQLGL
GTAGSVASGRVAYTLGLQGPALTVDTACSSSLVALHLAVQSLRRGECDLALAGGTTVMAT
PTVFVEFSRQRGLAPDGRCKPFADTADGTAWAEGVGMLLVERLSDAERLGHRVLAVVRGT
AVNQDGASNGLTAPSGPAQQQVIRDALADAHLTPDDIDAVEAHGTGTPLGDPIEAGALLA
TYGHPKRQTPVWLGSLKSNIGHTQAAAGIAGIIKMVQALRHDTLPRTLHADHPSSKVDWE
AGPLQLLAQARPWPADPDRPRRAGISAFGVSGTNAHAIIEEPPTLTEAPADTHTPPVIAW
PLSAHTPTALRAQAARLRARLHRTSDALSLADSAGIGHGLAVGRAALPHRAVLLGDGAAP
LDALAALASGEVSPDVVTGSAADVRRVAFVFPGQGAQWAGMGAELLDSSPVFAAELARCE
AALEPFVDWSLTDVLRGAPGAPGLDRVDVVQPVTFAVVVALAAMWRWLGVEPAAVVGHSQ
GEIAAAHVAGVLSLEDAARVVALRSQLIARELAGRGSMASVALAAADVESRLAGAEAGGG
VRDVEIAAVNGPETTVVCGAPGAVDSLLGVLQGEGVRVRRIDVDYASHSRHVEGIRDELA
AVLAGLRPRAGRVPFYSTVEAEPLDGTALDAGYWYRNLRQRVRFESALRAMLADGVDAFV
ECSPHPVLTVPVRQTLEDAGAGAVAVGSLRRDDGGLRRFLTSAAEAQVAGVPVDWAALCP
RAGWVDLPTYAFQRERYWVAPAEPGPAAGAGSAAATGPAAATAARSGSGQEDAASAYGDR
LAYHVAWQGLLPGADAWRPGPRLLIVPAGEREAEVADSVEQAIASFGGTVRRVTADPLST
GRDGLRALLAPVVAGEEPLTGAVSLLGLCTDGHPEHPGVPAGVTGTLALVQALADLGVAV
PLWTVTRGTVLVVGDSTTVPARLLRSLLDDGAERVVLAGADAGTATDAGTAELAPDAAVV
RIPCDVTDRSVLAGLLAKYRPAVVVHAPPLVPLAPLVETAPGDIAEAVAAKTAVAGHLVD
LAAGADLQALVLFSSVSGVWGGAAQGAYAAATAHLDALAERARAAGLPAVSVAWSPWAGG
AHAEGADEEFLSRRGLVPLDPDAAVRSLRRLLAGDSACGVVADVVWDRFVASYTSVRPTA
LFDDVPDVRELHAARRAADADDPATAELVRELSARSGDQRRAALLRLVRTHAAAVLGKAS
GDAVDSTRAFRELGFESLTAVELRGRLAEATGLTLPASLVFDHPTPAALARHLGERLFGD
EDGTAAAAKAPVVRKADAGEPIAIIGMACRLPGGVRSPEDLWELLSDGADAITAFPTDRG
WDNDALYDPDPAASRRTYARAGGFLHDAAEFDPGFFGISPREALAMDPQQRLSLETAWES
FERAGLDPTRLRGSRTGVFVGTNGQHYVPLLQSGGADGESFDGYISTGNSASVMSGRLSY
VFGLEGPAVTVDTACSASLTALHLSVQSLRRGECDLALVSGATVMATPEMLVDFARQRAI
SPDGRCKAFAEAADGVGLAEGAVALLVERLSDAERLGHRVLAVVRGTAVNQDGASNGLTA
PSGPAQQNVIRDALADAGLTAADIDAVEAHGTGTHLGDPIEAGALLATYGQAEDRGPLWL
GSLKSNIGHTQAAAGVAGVIKMVQALRHDTLPRTLHVDRPTSKVDWETGRVRLLTDARPW
PAGPDRPRRAGISAFGISGTNAHVVIEEPPPTAVPESPEPSPAEAPPRQEQDRDRWEGVT
VPLMLSAHSEAALREQARRLCAQLLARPEQRPADVGHALLSTRARFPRRAAVVGESMTEL
AEALDAVAEGGPHPLAATGTAGTADRVVFVFPGQGSQWAGMAEGLLERSGAFRSAADSCD
AALRPYLGWSVLSVLRGEPDAPSLDRVDVVQPVLFTMMVSLAAVWRALGVEPAAVVGHSQ
GEIAAAHVAGALSLDDSARIVALRSRAWLGLAGKGGMVAVPMPAEELRPRLVTWGDRLAV
AAVNSPGSCAVAGDPEALAELVALLTGEGVHARPIPGVDTAGHSPQVDALRAHLLEVLAP
VAPRPADIPFYSTVTGGLLDGTELDATYWYRNMREPVEFERATRALIADGHDVFLETSPH
PMLAVALEQTVTDAGTDAAVLGTLRRRHGGPRALALAVCRAFAHGVEVDPEAVFGPGARP
VELPTYPFQRERYWCHPGVRGGDPASLGMDGADHPLLGGGVELPDSGGHVYTARIGVDEF
PWMADHTLLGAVLLPGAAFADLALWAGRQSGAGRIEELTLSSPLTVPADGGVRLRLSVAG
RGPGGDRRFTVHARPEDAADWSLHAEGLLSPDEGAGEDAGAGAAAVAPGAEPLDVSDFYD
RFAERGYGYGPVFRGLVAAYRHGADIHAEVALPGSAQGDASRFGLHPALLDAALQTMSLG
TFFPEDGRVRMPFALRGIRLHRSGADRLWVRISPVAEDAVRVQCADAEGRPVAEIDSIVM
RPVDPGHLAHAGLSQVPDSLFALTWDAVPPPGAAANGAGAPLRWVVAGPDALSLAEAADA
HLPDLSDLPVPGPSAEGAPRPWGGRSAPDAGVFGVVGGDGCLDLEARALPAGCWSWCSGG
SRRPAGAEGPRLVVATRGAVAVQDDDEVTDPAAAAAWGLLRSAQAEEPGRFLLVDVDDDP
VSVRALPAAVASALASGEPQTAVRAGTAYLPRLDRAGAALIPPAGGGAWRLSRSADGTLD
GLALLPAPDADAPLEPGQVRVAVRAAGVNFRDALLALGMYPGEAELGTEGAGVVTETGPG
VTRFRPGDRVLGLWNGGFGPVCIADERLLAPVPEGWSFVRAASVPAVFLSAYYGLVALAG
LRRGETVLVHAAAGGVGMAAVQIARHLGAQVLATASPTKWDALRGLGVADEHIASSRTLD
FATAFSRESRPVGVDVVLNSLAYEYTDASLTLLGPGGRFLDLGRTDVRDPLRVAAEHPGV
QYRAFGLDEVDSGELGRMLTELMELFERGVLRPLPVATYDVRRAADALRTISQARHVGKL
VLTMPPAFGPYGTVLITGGTGTIGSRIARHLVTRHGVRHLLLASRGGPDGDGAAGLVAEL
ADAGASATVVACDVADADAVRRLLDEVPEQQPLTAVVHSAGVLDDGMLPSLTPERLERVL
RPKVDAAVHLDRLTRDLDLSAFVLFSSSAALLGSPAQGNYAAANAVLDALAARRRSLGLP
AVSVAWGLWTDSSRMHTLDQESLGRRFARSGFPPMPASLATALFDATLGVDEAVQYPMRL
DLAALRATGTVPPLLSRLVTRAADGAAAGQGRTDAVGGNGQVSGEAFAERLSALSDEERL
DTLLELVRELVAAVLGHGSAASVASDRAFREAGFDSLTAVELRNRLAAATGLRLPATLVF
DHPTPTALAGRLDELLAPRRPAGTDPVLAGLDRIEEALAALDPDGPAATVPAPRTPGEIA
SHLAALAGRWRALHNGTLNTGDTAQGTGDRIDDVLDAAADDEIFAYIDERFGTS
selected fasta
>polyketide synthase [polyketide synthase modules 4 and 5]
GTGTCCGCAACGAACGAGGAGAAGCTGCGGGAGTACCTTCGGCGCGCGATGGGCGATCTG
CACAGCGCACGCGAGCGGTTGGCGGAGCTGGAGTCGGCGCGCCATGAGCCGGTCGCGGTG
GTGGGCATGGCATGCCGCTACCCCGGCGGCGTGGCCACGCCCGACGACCTGTGGGAGCTG
GTGGCCTCCGGAACCGACGCCATCTCCACCTTCCCGACCGACCGCGGCTGGGACCTGGAC
GGCCTGTACGACCCCGACCCCAGCACGCCCGGCAAGAGCTACGTCCGCCACGGCGGCTTC
CTCCACGACGCGGCCCAGTTCGACGCCGAGTTCTTCGGCATCAGCCCCCGCGAAGCCACC
GCCATGGACCCCCAGCAACGCCTCCTGCTCGAAACCTCCTGGGAAGCCCTCGAACACGCC
GGGATCGCCCCCCACACCCTGCGCACCACCCGCACCGGCGTCTTCACCGGCGTCATGCAC
CACGACTACGGCAGTCACCAGGTCGGCAGCGCGGCCGACGCCAGTGGACAGCTGGGTCTT
GGTACGGCGGGGAGTGTGGCGTCGGGCCGGGTGGCGTACACGCTGGGCCTGCAGGGACCC
GCGCTCACCGTGGACACCGCGTGCTCCTCCTCGCTGGTGGCGCTGCACCTGGCCGTGCAG
TCGCTGCGGCGTGGGGAATGCGACCTCGCCCTCGCCGGTGGAACCACCGTCATGGCCACC
CCGACCGTCTTCGTCGAGTTCTCCCGCCAGCGCGGGCTGGCACCCGACGGCCGCTGCAAG
CCCTTCGCCGACACCGCCGACGGCACCGCGTGGGCCGAGGGCGTCGGCATGCTCCTGGTC
GAGCGACTCTCCGACGCCGAACGGCTAGGCCACCGCGTGCTGGCCGTCGTACGCGGCACC
GCCGTCAACCAGGACGGCGCCAGCAACGGCCTCACCGCCCCCAGCGGACCCGCCCAACAA
CAAGTCATCCGCGACGCCCTCGCCGACGCCCACCTCACCCCCGACGACATCGACGCCGTC
GAGGCCCACGGCACCGGCACCCCCCTCGGCGACCCCATCGAAGCCGGCGCCCTGCTGGCC
ACCTACGGACACCCCAAGCGTCAGACACCGGTCTGGCTCGGATCGCTGAAGTCCAACATC
GGCCACACCCAGGCCGCCGCCGGCATCGCCGGAATCATCAAGATGGTGCAGGCGCTGCGG
CACGACACCCTGCCGCGCACGCTGCACGCCGACCATCCCAGCAGCAAGGTCGACTGGGAG
GCCGGCCCGCTTCAGCTCCTCGCTCAGGCCCGGCCCTGGCCCGCCGACCCCGACCGGCCG
CGCCGCGCGGGTATCTCCGCCTTCGGCGTCAGCGGCACCAACGCCCACGCCATCATCGAA
GAACCACCCACCCTCACCGAAGCTCCCGCAGACACCCACACCCCACCCGTCATCGCCTGG
CCGCTGTCGGCCCACACCCCCACCGCCCTGCGCGCCCAGGCCGCCCGCCTGCGCGCCCGG
CTCCACCGCACCTCCGACGCCCTCTCCCTCGCCGACTCCGCCGGCATCGGTCACGGTCTG
GCCGTCGGGCGGGCCGCGCTGCCCCATCGGGCGGTGCTGCTCGGTGACGGCGCTGCCCCG
CTGGACGCCCTTGCCGCGTTGGCCTCGGGCGAGGTCTCGCCGGACGTCGTCACGGGCAGC
GCGGCCGATGTCCGCCGGGTCGCCTTCGTCTTTCCCGGCCAGGGCGCGCAGTGGGCCGGC
ATGGGCGCCGAACTCCTCGATTCCTCACCGGTGTTCGCGGCGGAGCTGGCGCGGTGCGAG
GCCGCGCTCGAGCCGTTCGTGGACTGGTCGCTCACCGATGTGCTCCGCGGAGCGCCGGGG
GCGCCCGGTCTGGACCGGGTGGACGTCGTGCAGCCGGTGACCTTCGCCGTCGTGGTCGCT
CTCGCGGCGATGTGGCGGTGGCTCGGTGTCGAGCCGGCTGCCGTGGTCGGCCACTCCCAG
GGCGAGATCGCCGCCGCTCACGTCGCCGGGGTGCTCTCACTGGAGGACGCCGCCAGGGTG
GTGGCGCTGCGCTCTCAGCTCATCGCCCGTGAACTCGCGGGGCGGGGCAGTATGGCATCG
GTGGCGCTGGCCGCGGCCGACGTCGAGTCGCGACTGGCTGGTGCGGAGGCCGGCGGTGGT
GTCCGGGACGTCGAGATCGCGGCCGTCAACGGACCGGAGACGACCGTCGTCTGCGGCGCG
CCCGGCGCGGTGGACTCGCTGCTGGGCGTGCTGCAGGGCGAGGGCGTCCGGGTCCGTCGT
ATCGACGTGGACTACGCGTCGCACTCCCGCCATGTCGAGGGGATCCGGGACGAGTTGGCG
GCCGTACTCGCGGGGCTCCGGCCGCGCGCGGGCCGCGTGCCCTTCTACTCGACCGTCGAG
GCGGAGCCGCTGGACGGGACGGCGCTCGACGCCGGGTACTGGTACCGCAACCTGCGCCAA
CGGGTGCGGTTCGAGTCCGCGCTGCGGGCGATGCTGGCCGACGGGGTGGACGCCTTCGTG
GAGTGCTCCCCGCACCCGGTACTCACCGTCCCCGTACGGCAGACCCTGGAGGACGCCGGG
GCGGGCGCGGTGGCCGTCGGCTCGCTGCGGCGCGACGACGGCGGCCTGCGGCGGTTCCTC
ACATCCGCCGCGGAAGCCCAGGTCGCAGGGGTTCCGGTGGACTGGGCGGCGCTCTGTCCG
CGTGCGGGGTGGGTGGACCTGCCCACCTACGCCTTCCAGCGCGAGCGGTACTGGGTGGCC
CCGGCTGAACCGGGGCCGGCGGCCGGGGCGGGTTCGGCGGCCGCGACCGGTCCGGCGGCG
GCCACCGCCGCCCGGAGCGGCTCCGGGCAGGAGGATGCCGCCTCGGCGTACGGTGACCGG
CTCGCGTACCACGTCGCCTGGCAGGGGCTGCTGCCGGGCGCCGACGCTTGGCGGCCGGGG
CCGCGGCTGCTGATCGTGCCGGCCGGGGAGCGGGAGGCCGAGGTCGCCGACTCCGTGGAG
CAGGCGATCGCCTCCTTCGGGGGGACGGTCCGCCGGGTCACGGCCGACCCGCTGTCGACC
GGCCGCGACGGGCTCCGCGCCCTGCTCGCGCCCGTGGTCGCCGGGGAGGAGCCGCTGACC
GGTGCCGTGTCGCTGCTGGGCCTGTGCACGGACGGCCACCCGGAGCATCCCGGAGTGCCC
GCGGGGGTCACCGGGACCCTCGCCCTCGTCCAGGCGCTGGCCGATCTCGGCGTCGCCGTA
CCGCTGTGGACGGTCACCCGGGGCACGGTCCTCGTCGTGGGGGACTCCACGACGGTGCCC
GCCCGGCTGCTGCGGTCCCTGCTGGACGACGGAGCGGAACGCGTGGTGCTGGCCGGGGCG
GACGCCGGGACGGCGACTGACGCCGGAACAGCCGAGCTGGCCCCCGACGCGGCTGTGGTC
CGGATCCCCTGTGATGTCACCGACCGGTCCGTTCTGGCCGGTCTGCTCGCGAAGTACCGT
CCGGCCGTCGTCGTCCACGCGCCGCCGCTGGTGCCGCTGGCACCTCTCGTCGAGACGGCG
CCCGGTGACATCGCCGAGGCGGTGGCCGCGAAGACGGCCGTCGCCGGTCATCTGGTCGAT
CTGGCGGCCGGGGCCGATCTGCAGGCGCTGGTGCTGTTCTCCTCCGTCTCGGGTGTGTGG
GGCGGCGCGGCCCAGGGCGCCTACGCGGCGGCCACCGCGCACCTGGACGCCCTCGCCGAA
CGTGCCCGGGCCGCCGGTCTGCCCGCAGTGTCGGTCGCGTGGAGTCCCTGGGCGGGCGGC
GCCCATGCGGAGGGCGCCGACGAGGAGTTCCTGAGCCGGCGCGGGCTGGTCCCGCTCGAT
CCCGATGCGGCGGTGCGCTCGCTGCGCCGGCTGCTGGCGGGGGACAGCGCGTGCGGCGTC
GTGGCCGACGTCGTATGGGACCGCTTCGTCGCCTCGTACACGTCCGTACGGCCGACAGCC
CTGTTCGACGACGTGCCCGACGTGCGGGAGCTGCACGCCGCACGGCGCGCGGCGGACGCC
GACGACCCGGCCACCGCCGAGCTGGTGCGGGAGCTGTCCGCCCGGTCCGGCGACCAGCGG
CGGGCCGCGCTGCTGCGACTGGTCCGCACCCATGCCGCCGCCGTGCTGGGGAAGGCGTCC
GGCGACGCGGTGGACAGTACGCGGGCCTTCCGTGAGCTGGGCTTCGAGTCGCTGACGGCG
GTCGAGCTGCGCGGCCGGCTCGCGGAGGCGACCGGGCTGACGCTGCCCGCCTCCCTGGTC
TTCGACCATCCCACCCCCGCCGCACTCGCCCGCCACCTCGGAGAGAGGCTCTTCGGCGAC
GAGGACGGCACGGCCGCCGCTGCGAAGGCCCCTGTGGTGCGGAAGGCGGACGCGGGCGAG
CCGATCGCGATCATCGGCATGGCGTGCCGGCTGCCGGGCGGGGTGCGGTCCCCGGAGGAC
CTGTGGGAACTGCTCTCCGACGGGGCCGACGCCATCACCGCCTTCCCCACCGACCGGGGC
TGGGACAACGACGCCCTCTACGACCCCGACCCCGCCGCGTCGCGCCGCACCTACGCCCGC
GCGGGCGGGTTCCTGCACGACGCGGCCGAGTTCGACCCCGGCTTCTTCGGGATCAGCCCG
CGCGAGGCGCTGGCGATGGACCCGCAGCAGCGGCTGAGCCTGGAGACGGCCTGGGAGTCC
TTCGAACGGGCCGGGCTCGACCCCACGCGACTGCGCGGCAGCCGCACGGGGGTCTTCGTG
GGCACGAACGGCCAGCACTATGTGCCGTTGCTGCAGAGCGGGGGCGCGGACGGGGAGAGT
TTCGACGGCTACATCTCCACGGGCAACTCCGCCAGCGTGATGTCCGGCCGGCTGTCGTAC
GTCTTCGGACTGGAGGGGCCCGCGGTCACCGTCGACACGGCCTGTTCCGCCTCCCTCACC
GCGCTGCATCTGTCGGTGCAGTCGCTGCGCCGTGGGGAGTGCGATCTGGCGCTGGTCAGC
GGTGCCACGGTGATGGCCACTCCGGAGATGCTGGTGGACTTCGCGCGGCAGCGTGCGATC
TCGCCGGACGGCCGCTGCAAGGCGTTCGCCGAGGCCGCCGACGGCGTCGGTCTGGCCGAG
GGTGCCGTGGCGCTGCTGGTGGAGCGGTTGTCGGACGCCGAGCGGCTCGGCCACCGCGTG
CTGGCCGTCGTGCGCGGCACCGCCGTCAACCAGGACGGCGCCAGCAACGGCCTCACCGCC
CCCAGCGGACCCGCCCAGCAGAACGTCATCCGCGACGCCCTCGCCGACGCCGGCCTCACC
GCGGCCGACATCGACGCCGTCGAGGCCCACGGGACCGGCACCCACCTCGGCGACCCCATC
GAAGCCGGCGCCCTGCTGGCCACCTACGGGCAGGCCGAAGACCGCGGTCCTCTGTGGCTC
GGGTCGTTGAAGTCCAACATCGGCCACACCCAGGCCGCCGCCGGTGTCGCCGGAGTCATC
AAGATGGTGCAGGCGTTGCGGCACGACACCCTGCCGCGCACGCTCCACGTCGACCGCCCC
ACCAGCAAGGTCGACTGGGAGACCGGCCGGGTGCGGCTCCTGACCGACGCCCGGCCCTGG
CCCGCCGGCCCCGACCGGCCGCGCCGCGCCGGCATCTCCGCCTTCGGCATCAGCGGCACC
AACGCCCACGTCGTCATCGAGGAACCGCCCCCGACGGCCGTGCCCGAGTCGCCCGAGCCG
TCTCCGGCGGAAGCGCCGCCGCGGCAGGAGCAGGACCGGGACCGGTGGGAGGGGGTGACC
GTGCCGCTGATGCTGTCCGCGCACAGCGAGGCCGCACTGCGCGAGCAGGCGCGACGGCTG
TGCGCGCAGCTCCTCGCGCGTCCCGAACAGCGTCCCGCCGACGTCGGACACGCCCTGCTC
AGCACCCGGGCCCGCTTCCCACGGCGGGCGGCGGTGGTCGGCGAGAGCATGACGGAGCTT
GCCGAGGCCCTCGACGCCGTCGCCGAGGGCGGCCCGCATCCGCTGGCGGCGACCGGCACC
GCGGGAACGGCCGACCGTGTCGTGTTCGTGTTCCCCGGCCAGGGCTCGCAGTGGGCCGGA
ATGGCCGAGGGGCTGCTGGAGCGGTCCGGCGCGTTCCGGAGTGCGGCCGACTCGTGCGAC
GCCGCGCTGCGGCCGTACCTCGGCTGGTCGGTGCTGAGCGTGCTGCGCGGGGAACCGGAC
GCGCCCTCGCTCGACCGGGTCGACGTCGTGCAGCCGGTGCTGTTCACGATGATGGTCTCG
CTCGCGGCGGTCTGGCGTGCGCTGGGGGTGGAACCGGCGGCGGTCGTCGGGCACTCGCAG
GGTGAGATCGCCGCTGCCCATGTCGCCGGTGCGCTGTCGCTGGACGACTCGGCCCGGATC
GTCGCCCTGCGCAGTCGGGCGTGGCTCGGACTGGCGGGCAAGGGCGGCATGGTGGCGGTG
CCGATGCCGGCGGAGGAGCTGCGGCCGCGGCTGGTGACGTGGGGGGACCGTCTGGCCGTC
GCCGCCGTCAACAGCCCCGGTTCCTGCGCCGTCGCAGGCGACCCGGAGGCGCTGGCCGAA
CTGGTGGCGCTGCTGACCGGTGAGGGGGTGCACGCCCGGCCGATCCCCGGCGTCGACACG
GCGGGCCACTCGCCGCAGGTGGACGCGTTGCGGGCTCATCTGCTGGAGGTGCTGGCCCCG
GTCGCCCCCCGACCGGCCGACATCCCGTTCTACTCGACGGTGACCGGCGGGCTGCTGGAC
GGCACCGAGCTGGACGCGACGTACTGGTACCGCAACATGCGCGAGCCCGTCGAGTTCGAG
CGGGCCACACGGGCGCTGATCGCCGACGGGCACGACGTCTTCCTGGAGACGAGCCCGCAT
CCCATGCTGGCCGTGGCGCTGGAGCAGACGGTCACCGACGCCGGCACCGACGCGGCGGTG
CTCGGGACCCTGCGCCGCCGCCACGGCGGTCCTCGCGCGCTGGCCCTGGCCGTCTGCCGC
GCCTTCGCGCACGGCGTGGAGGTGGACCCCGAGGCGGTCTTCGGTCCGGGCGCACGGCCC
GTGGAGTTGCCCACCTATCCGTTCCAGCGGGAGCGCTACTGGTGCCACCCCGGTGTCCGG
GGCGGCGACCCGGCCTCCCTGGGCATGGATGGTGCCGATCATCCGCTGCTCGGCGGCGGC
GTGGAACTGCCCGACTCCGGCGGCCATGTGTACACCGCGCGGATCGGCGTCGACGAGTTC
CCCTGGATGGCCGACCACACCCTGCTGGGAGCGGTGCTGTTGCCGGGTGCGGCCTTCGCC
GACCTCGCGCTGTGGGCGGGGCGCCAGAGCGGCGCCGGGCGGATCGAGGAACTCACGCTG
TCGTCGCCGCTGACGGTGCCCGCCGACGGTGGGGTCCGGTTGCGGCTGAGCGTGGCGGGC
CGGGGGCCGGGCGGGGACCGCCGCTTCACCGTCCACGCCCGCCCGGAGGACGCCGCCGAC
TGGAGCCTGCACGCCGAGGGCCTCCTCTCGCCGGACGAGGGCGCGGGTGAAGACGCGGGT
GCGGGCGCGGCCGCTGTTGCGCCGGGTGCCGAGCCGCTGGACGTCAGCGACTTCTACGAC
CGGTTCGCCGAGCGCGGCTACGGGTACGGGCCCGTGTTCCGCGGCCTGGTGGCGGCGTAC
CGGCACGGTGCCGACATCCACGCGGAGGTGGCGCTGCCCGGCTCGGCCCAGGGCGACGCG
TCGCGGTTCGGACTGCATCCCGCGCTGCTGGACGCGGCCCTGCAGACGATGAGTCTCGGG
ACGTTCTTCCCCGAGGACGGGCGGGTGCGGATGCCGTTCGCGCTGCGTGGCATACGGCTG
CACCGCTCGGGTGCCGACCGGCTGTGGGTCCGGATCTCGCCGGTGGCCGAGGACGCGGTC
CGGGTCCAGTGCGCCGACGCCGAGGGGCGACCGGTCGCCGAGATCGACTCGATCGTCATG
CGCCCGGTCGACCCCGGTCATCTGGCGCACGCCGGCCTCAGCCAGGTTCCCGACTCCCTG
TTCGCACTCACCTGGGACGCCGTTCCCCCGCCCGGCGCCGCGGCGAACGGCGCCGGCGCG
CCGCTGCGCTGGGTGGTCGCGGGACCCGACGCCCTGTCCCTGGCCGAGGCAGCCGACGCC
CACCTGCCCGACCTGTCCGACCTGCCCGTCCCGGGCCCGAGCGCCGAGGGCGCACCGCGA
CCGTGGGGCGGGCGGTCCGCACCGGACGCGGGCGTGTTCGGTGTGGTGGGCGGGGACGGG
TGCCTTGACCTGGAGGCTCGGGCGTTGCCCGCCGGGTGCTGGAGCTGGTGCAGCGGTGGC
TCGCGGCGACCGGCCGGAGCCGAGGGGCCGCGGCTCGTCGTGGCGACCCGGGGCGCGGTC
GCGGTGCAGGACGACGACGAGGTGACCGACCCGGCGGCGGCCGCCGCGTGGGGTCTGCTG
CGTTCCGCGCAGGCCGAGGAACCCGGCCGGTTCCTGCTCGTCGACGTGGACGACGACCCG
GTGTCGGTACGAGCCCTGCCCGCCGCCGTCGCCTCGGCCCTCGCCTCGGGCGAACCGCAG
ACGGCGGTGCGGGCCGGCACGGCGTACCTGCCCAGGCTGGACCGCGCCGGCGCCGCGCTC
ATCCCGCCGGCCGGTGGCGGTGCGTGGCGGCTGAGCCGGAGTGCGGACGGCACCCTGGAC
GGGCTGGCCCTGCTGCCCGCTCCCGATGCGGACGCCCCGCTGGAGCCGGGGCAGGTGCGG
GTCGCGGTGCGTGCCGCCGGTGTCAACTTCAGGGACGCCCTCCTCGCCCTGGGCATGTAT
CCGGGCGAGGCCGAGCTGGGCACCGAGGGAGCGGGCGTCGTCACCGAGACCGGTCCCGGT
GTCACCCGGTTCCGCCCCGGCGACCGGGTGCTGGGCCTGTGGAACGGCGGTTTCGGTCCC
GTGTGCATCGCCGACGAGCGGCTGCTCGCGCCGGTACCGGAGGGCTGGTCCTTCGTCCGC
GCCGCGTCGGTCCCGGCGGTGTTCCTGAGCGCCTACTACGGCCTGGTCGCTCTGGCCGGC
CTGCGGCGCGGGGAGACAGTGCTGGTGCACGCCGCCGCCGGAGGCGTCGGGATGGCCGCC
GTGCAGATCGCCCGCCATCTGGGCGCGCAGGTGCTGGCGACCGCGAGCCCCACCAAGTGG
GACGCCCTGCGCGGCCTGGGCGTCGCGGACGAGCACATCGCCTCCTCCCGCACCCTCGAC
TTCGCGACGGCGTTCTCCCGCGAGAGCCGGCCGGTCGGCGTCGACGTCGTCCTCAACTCG
CTGGCGTACGAGTACACCGACGCGTCCCTGACCCTGCTCGGCCCCGGCGGACGGTTCCTG
GACCTGGGCCGAACCGACGTACGCGACCCGCTCCGGGTCGCTGCGGAACATCCCGGCGTC
CAGTACCGGGCGTTCGGCCTGGACGAGGTGGACTCCGGTGAACTCGGCCGGATGCTCACC
GAGTTGATGGAGCTGTTCGAGCGGGGCGTACTGCGGCCGCTGCCGGTCGCCACGTACGAC
GTGCGTCGCGCCGCCGACGCCCTGCGCACGATCAGCCAGGCCCGGCACGTCGGCAAGCTG
GTGCTGACGATGCCGCCCGCGTTCGGCCCGTACGGCACGGTGCTCATCACGGGCGGCACG
GGGACGATCGGCAGCCGGATCGCCCGGCATCTGGTCACCCGGCACGGCGTTCGACACCTG
CTGCTGGCCTCGCGCGGCGGCCCGGACGGCGACGGCGCCGCCGGACTCGTCGCGGAACTG
GCCGACGCGGGCGCGTCGGCCACGGTCGTGGCCTGCGACGTGGCCGACGCGGACGCGGTG
CGGCGGCTGCTCGACGAAGTACCCGAGCAGCAGCCCCTGACAGCGGTGGTGCACAGCGCG
GGCGTCCTCGACGACGGCATGCTGCCCTCCCTCACCCCCGAGCGGCTGGAACGGGTGCTG
CGGCCCAAGGTGGACGCCGCCGTGCACCTGGACCGGCTCACCCGGGACCTGGACCTGTCG
GCGTTCGTCCTGTTCTCGTCCAGCGCCGCGCTGCTGGGCAGCCCCGCCCAGGGCAACTAC
GCGGCGGCCAACGCCGTGCTCGACGCCCTCGCGGCCCGGCGGCGCTCACTCGGTCTGCCG
GCGGTTTCAGTGGCGTGGGGGCTGTGGACGGACAGCAGCCGTATGCACACGCTGGACCAG
GAGAGCCTGGGCCGGCGGTTCGCGCGGAGCGGCTTCCCGCCCATGCCGGCGTCCCTGGCC
ACCGCGTTGTTCGACGCGACGCTCGGGGTGGACGAGGCGGTCCAGTACCCCATGCGGCTG
GATCTGGCCGCGCTGCGTGCCACCGGGACGGTTCCGCCTCTGCTGTCACGGCTCGTCACA
CGTGCTGCGGACGGCGCGGCGGCCGGGCAGGGCCGGACGGACGCCGTCGGCGGCAACGGT
CAGGTGAGCGGTGAGGCGTTCGCGGAGCGTCTGTCCGCCCTGTCGGACGAGGAACGCCTC
GACACACTGCTGGAGCTGGTGCGTGAACTCGTCGCCGCGGTGCTGGGCCACGGCTCCGCC
GCCTCGGTCGCCTCGGACCGGGCCTTCCGCGAGGCGGGCTTCGACTCCCTGACCGCGGTG
GAACTGCGCAACCGGCTGGCCGCGGCGACGGGTCTGCGGCTGCCCGCGACCCTGGTGTTC
GACCATCCGACGCCGACCGCGCTGGCCGGCCGTCTGGACGAGTTGCTCGCGCCGCGGCGG
CCTGCCGGTACCGACCCCGTCCTGGCCGGACTCGACCGGATCGAGGAGGCGCTGGCCGCC
CTCGATCCCGACGGCCCGGCCGCCACGGTTCCCGCACCCCGGACCCCGGGCGAGATCGCG
TCGCACCTGGCCGCCCTGGCCGGCCGCTGGCGCGCTCTCCACAACGGCACCCTGAACACC
GGCGACACCGCCCAAGGCACCGGCGATCGCATCGACGACGTCCTGGATGCCGCGGCCGAC
GACGAGATCTTCGCGTACATCGACGAACGGTTCGGCACGTCCTGA
[4] KS36..410
[4] AT569..892
[4] methylmalonyl-CoA765..769
[4] kr1088..1260
[4] ACP1364..1434
[5] KS1460..1838
[5] AT2008..2328
[5] ethylmalonyl-CoA2200..2204
[5] DH2374..2536
[5] ER2877..3182
[5] KR3192..3372
[5] ACP3483..3553
[4] KS106..1230
[4] AT1705..2676
[4] methylmalonyl-CoA2293..2307
[4] kr3262..3780
[4] ACP4090..4302
[5] KS4378..5514
[5] AT6022..6984
[5] ethylmalonyl-CoA6598..6612
[5] DH7120..7608
[5] ER8629..9546
[5] KR9574..10116
[5] ACP10447..10659

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [558-691]  G3DSA:3.40.366.10 [765-882]  G3DSA:3.40.366.10 [2001-2131]  G3DSA:3.40.366.10 [2200-2314]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [1088-1247]  1.1e-27 PF00106 [3192-3359]  2.59999999999998e-60 PF00106
PF00106   adh_short
IPR002364 Quinone oxidoreductase/zeta-crystallin, conserved site (Conserved_site)
 [3004-3025]  PS01162
PS01162   QOR_ZETA_CRYSTAL
IPR006162 Phosphopantetheine attachment site (PTM)
 [1392-1407]  PS00012 [3511-3526]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1364-1434]  PS50075 [3483-3553]  PS50075
PS50075   ACP_DOMAIN
 [1362-1437]  6.59999999999996e-44 G3DSA:1.10.1200.10 [3481-3557]  6.59999999999996e-44 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1357-1476]  1.29999924468179e-26 SSF47336 [3475-3570]  1.60000240695997e-23 SSF47336
SSF47336   ACP_like
 [1367-1433]  1.3e-12 PF00550 [3486-3551]  1.3e-11 PF00550
PF00550   PP-binding
IPR011032 GroES-like (Domain)
 [2868-3013]  4.40000933643891e-32 SSF50129
SSF50129   GroES_like
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [2896-2954]  1.6e-07 PF08240
PF08240   ADH_N
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [36-286]  9.60000000000003e-102 PF00109 [1460-1713]  8.39999999999977e-94 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [294-410]  2.89999999999999e-47 PF02801 [1721-1838]  3.89999999999997e-47 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [569-892]  6.7999999999999e-105 PF00698 [2008-2328]  1.99999999999999e-103 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [6-36]  2.10000037262656e-06 SSF101173
SSF101173   Polyketide_synth_docking
 [4-29]  6.3e-11 PF08990
PF08990   Docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [566-874]  2.59998233910302e-72 SSF52151 [2006-2298]  7.29994178862692e-66 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [694-764]  1.09999909120787e-14 SSF55048 [2133-2199]  3.59999643435987e-15 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [36-297]  G3DSA:3.40.47.10 [298-464]  6.40000000000019e-130 G3DSA:3.40.47.10 [1462-1725]  G3DSA:3.40.47.10 [1726-1891]  6.40000000000019e-130 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [28-409]  1.59998835313644e-105 SSF53901 [1452-1836]  8.6000633021393e-101 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1084-1279]  2.1e-50 G3DSA:3.40.50.720 [2967-3157]  7.5e-46 G3DSA:3.40.50.720 [3193-3373]  1.9e-49 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [199-215]  PS00606 [1626-1642]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [570-873]  4.20003460493095e-124 SM00827 [2010-2308]  6.69996745106047e-112 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1365-1437]  8.79996401030972e-34 SM00823 [3484-3556]  2.39999798157265e-34 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [2374-2536]  1.50000965748778e-69 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [38-464]  SM00825 [1462-1891]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1088-1260]  3.59999643435987e-13 SM00822 [3192-3372]  3.89999861795218e-61 SM00822
SM00822   PKS_KR
IPR020843 Polyketide synthase, enoylreductase (Domain)
 [2877-3182]  SM00829
SM00829   PKS_ER
SignalP No significant hit
TMHMM No significant hit