close all open/close all

CDS information : Nidda_00050


close this sectionLocation

Organism
StrainNRRL 2821
Entry nameNiddamycin
Contig
Start / Stop / Direction30,294 / 35,003 / + [in whole cluster]
30,294 / 35,003 / + [in contig]
Location30294..35003 [in whole cluster]
30294..35003 [in contig]
TypeCDS
Length4,710 bp (1,569 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)polyketide synthase module 6
Gene
Gene (GenBank)nidA4
EC number
Keyword
Note
Note (GenBank)
  • orf4
Reference
ACC
PmId
[9393718] Identification and characterization of the niddamycin polyketide synthase genes from Streptomyces caelestis. (J Bacteriol. , 1997)

close this sectionPKS/NRPS Module

6 hydroxylmalonyl-CoA or methoxymalonyl-ACP
KS44..417
AT574..893
KR1165..1345
ACP1447..1517

close this sectionSequence

selected fasta
>polyketide synthase [polyketide synthase module 6]
MENEAPKESNEPDAAKLRSYLRRVTAELHRATEQLRAVEERAREPIAIVGMACRLPGGVR
GPEDLWELLRSETDAVSPAPSDRGWDVTAMYSPDPDRPGTTYCREGGFVRGVDRFDPGLF
GISPNEALAMDPQQRLLLETVWESLERAGIDPKSLRGSRTGVFAGAWESGYQKGLDAADA
GLEAQLLAGIVSFTAGRVSYTLGLEGPAMTVDTACSSSLVALHLAVQSLRRRECDLALAG
GATVIADPALLVQFSRQRALAPDGRCKAFAEAADGFGPAEGAGMLLVERLSDAERLGHRV
LAVVRGTAVNQDGASNGLTAPSGPAQQKVIRDALADAGLRADDIDAVEAHGTGTPLGDPI
EAGALLATYGHPERRKPLWLGSLKSNIGHTQAAAGVAGIIKMVQALRHDTLPRTLHADHP
SSKVDWDAGPLRLLTDARPWPADPDRPRRAGISSFGVSGTNAHVVLEEPPASEEAPPPPP
ATSPMTVLPLSAAGAVSLREQARRLADHLDAHPEITPADAAYSAATTRAALSHRASVPAG
DRESLIARLRSVAEERPEPDVVLGEAGSDRAPAFVFPGQGAQWAGLGARLLADSPVFRAR
AEACARALEPHLDWSVLDVLAGAPGTPPIDRADVVQPVLFTTMVSLAALWEAHGVRPAAV
VGHSQGEVAAACVAGALSLDDAALVIAGRSRLWGRLAGNGGMLAVMAPAERIRELLEPWR
QRISVAAVNGPASVTVSGDALALEEFGARLSAEGVLRWPLPGVDFAGHSPQVEEFRAELL
DLLSGVRPAPSRIPFFSTVTAGPCGGDQLDGAYWYRNTREPVEFDATVRALLRAGHHTFI
EVGPHPLLNAAIDEIAADEGVAATALHTLQRGAGGLDRVRNAVGAAFAHGVRVDWNALFE
GTGARRVPLPSYAFHRDRFWLPTAAARRPATSSSRPTDAWRYRVTWTALETPAGNGRLTG
RWLVIWSRNGDPLLPDITTALHTAGADTHTLTLDPTTTDKDTLATHLTHIATAHPDGLSG
ILLAPTPVTPDPHQPPLDPATTLTLTTIQALTTTPLTTPLWITTRQATTIHPTDTPNPYT
ARLWGLGQTAALEHPQHWGGLIDLPEHPTPHHLHHLTTHLATSQDPNPRQPHEDQIAIRT
HTTYARRLTPTTPTTTPTPWTPPPGTILITGGTGALGTHIATWLAHKGAKHLILTSRQGP
NAPGATQLQHHLTQLGTHTTITPCDLTDPQQIENLINHINTHHPPLQAIFHTAGTPQTTP
LTHLTPTQATDILNAKTTGAELLHHHTTHTPLHTVVHFSSAAATWGSSGQSLYAAANAHL
DALAQHTHTQGQPTTSIAWGLWGGGGMGESPEVVDYYAKRGLSPMRPESAIEALERALSL
GDTCVTVADVDWKRFAAGYTAYRPSRLISDIPEIRDLQASAPVVDKSGELTERLNAALTP
RERNKILVELVRSVAAEVLGHDGTDRIGHDVAFKDLGFDSLAAVKMRTRLRETTGLDLPA
TVIFDHPTVDRLAAMLLAERTDPSGPTGPADRPGAAAPVPEPRPAADAGEIDALSPAELI
RLAKTGAGQ
selected fasta
>polyketide synthase [polyketide synthase module 6]
GTGGAGAACGAAGCTCCGAAGGAGTCGAACGAGCCGGACGCGGCGAAGCTGCGCTCCTAC
CTCAGGCGCGTGACGGCCGAGCTGCACCGGGCCACCGAGCAACTGCGGGCCGTCGAGGAG
CGGGCGCGGGAACCGATCGCGATCGTCGGCATGGCCTGCCGGCTGCCCGGCGGGGTGCGC
GGGCCGGAGGACCTGTGGGAGCTGCTGCGCTCGGAGACCGACGCCGTCTCCCCGGCACCG
TCCGACCGCGGCTGGGACGTGACGGCGATGTACTCGCCCGACCCGGACCGGCCGGGGACG
ACGTACTGCCGCGAGGGGGGATTCGTCCGGGGAGTCGACCGGTTCGACCCCGGCCTGTTC
GGGATCTCTCCGAACGAGGCACTGGCCATGGACCCCCAGCAGCGGCTCCTGCTGGAGACG
GTGTGGGAATCGCTGGAACGGGCCGGCATCGACCCGAAGTCGTTACGGGGCAGCCGCACC
GGGGTGTTCGCCGGTGCCTGGGAGAGCGGCTACCAGAAGGGGCTGGACGCGGCCGACGCG
GGGCTGGAGGCCCAGCTCCTGGCCGGGATCGTCAGTTTCACGGCGGGCCGGGTCTCGTAC
ACCCTGGGTCTCGAGGGTCCCGCCATGACGGTGGACACGGCGTGTTCGTCGTCGCTGGTG
GCGCTGCATCTCGCGGTGCAGTCGCTGCGCCGCCGCGAGTGCGACCTCGCCCTCGCCGGC
GGTGCGACGGTCATCGCCGACCCCGCCCTCCTCGTGCAGTTCTCGCGGCAGCGGGCGCTG
GCGCCGGACGGCCGCTGCAAGGCCTTCGCCGAGGCCGCCGACGGTTTCGGGCCCGCCGAG
GGTGCCGGGATGCTGCTGGTGGAGCGGCTCTCCGACGCCGAGCGGCTCGGCCACCGCGTG
CTGGCCGTCGTGCGTGGCACCGCCGTCAACCAGGACGGCGCCAGCAACGGCCTCACCGCC
CCCAGCGGACCCGCCCAGCAGAAGGTCATCCGCGACGCCCTGGCCGACGCCGGCCTCCGC
GCCGACGACATCGACGCCGTCGAGGCCCACGGCACCGGCACCCCCCTCGGCGACCCCATC
GAAGCCGGCGCCCTGCTGGCCACCTACGGACACCCCGAACGCCGGAAACCGCTCTGGCTG
GGGTCGCTGAAGTCCAACATCGGCCACACCCAGGCCGCCGCCGGCGTCGCCGGAATCATC
AAGATGGTGCAGGCGCTGCGGCACGACACCCTGCCGCGCACCCTCCACGCCGACCATCCC
AGCAGCAAGGTCGACTGGGACGCCGGCCCGCTTCGGCTCCTGACCGACGCCCGGCCCTGG
CCCGCCGACCCCGACCGGCCGCGCCGCGCCGGTATCTCCTCGTTCGGCGTCAGCGGCACC
AACGCCCACGTCGTGCTCGAAGAACCACCGGCCTCGGAGGAAGCACCTCCGCCGCCCCCG
GCCACGTCTCCGATGACCGTCCTCCCTCTGTCGGCCGCCGGGGCGGTATCCCTGCGCGAG
CAGGCCCGGCGGCTCGCCGATCATCTCGACGCCCATCCGGAGATCACGCCGGCCGATGCC
GCGTACTCCGCCGCCACCACCCGCGCGGCGCTCTCCCACCGGGCCTCGGTCCCGGCGGGC
GACCGTGAGTCGCTGATCGCGCGGCTGCGCTCGGTCGCGGAGGAGCGGCCGGAGCCCGAC
GTCGTGCTCGGTGAGGCCGGCAGCGACCGCGCGCCTGCCTTCGTCTTTCCCGGGCAGGGC
GCCCAGTGGGCCGGACTGGGAGCGCGGCTCCTCGCGGACTCCCCCGTCTTCCGCGCCAGG
GCCGAGGCATGCGCGCGGGCGCTGGAGCCTCACCTCGACTGGTCGGTCCTCGACGTGCTG
GCCGGCGCCCCGGGCACCCCTCCCATCGACCGGGCCGACGTGGTGCAGCCGGTGCTGTTC
ACCACGATGGTCTCGCTGGCCGCCCTCTGGGAGGCCCACGGGGTGCGGCCGGCCGCGGTC
GTGGGCCACTCCCAGGGCGAGGTGGCCGCGGCCTGCGTGGCCGGTGCCCTGTCGCTGGAC
GACGCTGCCCTGGTGATCGCCGGACGCAGCAGGCTGTGGGGGCGGCTGGCCGGGAACGGC
GGGATGCTCGCGGTGATGGCTCCGGCCGAGCGGATCCGTGAGCTGCTCGAACCATGGCGG
CAGCGGATTTCGGTGGCGGCGGTCAATGGCCCCGCCTCGGTCACCGTCTCCGGTGACGCG
CTCGCGCTGGAGGAGTTCGGCGCGCGGCTCTCCGCCGAGGGGGTGCTGCGCTGGCCGCTG
CCGGGCGTCGACTTCGCCGGCCACTCGCCGCAGGTGGAGGAGTTCCGCGCTGAGCTCCTG
GACCTGCTCTCCGGCGTACGGCCGGCTCCTTCGCGGATACCTTTCTTCTCCACCGTGACG
GCGGGTCCTTGCGGCGGCGACCAGCTGGACGGGGCGTACTGGTACCGCAACACGCGCGAA
CCCGTGGAGTTCGACGCCACGGTCCGGGCGCTGCTGCGTGCGGGCCATCACACGTTCATC
GAGGTCGGTCCGCATCCGCTGCTCAACGCCGCGATCGACGAGATCGCAGCGGACGAGGGG
GTAGCGGCCACGGCCCTGCATACGCTCCAGCGGGGCGCTGGCGGCCTTGACCGCGTGCGC
AACGCGGTGGGCGCCGCTTTCGCGCACGGTGTCCGGGTCGACTGGAACGCCCTGTTCGAG
GGCACCGGTGCGCGCAGGGTGCCGCTTCCCTCGTACGCCTTCCATCGTGACCGGTTCTGG
CTGCCGACCGCTGCCGCCCGGCGGCCCGCGACGTCGTCGTCCCGGCCCACGGACGCCTGG
CGTTACCGGGTGACCTGGACGGCTCTGGAAACTCCGGCCGGCAACGGGAGGCTGACAGGT
CGTTGGCTGGTGATCTGGTCACGGAACGGGGACCCCCTCCTCCCCGACATCACCACCGCC
CTGCACACCGCGGGCGCCGACACCCACACCCTCACCCTCGACCCCACCACCACCGACAAA
GACACACTCGCCACCCACCTCACCCACATCGCCACCGCCCACCCCGACGGCCTCAGCGGC
ATCCTCCTCGCCCCCACCCCCGTCACACCCGACCCCCACCAACCCCCACTCGACCCCGCC
ACCACCCTCACCCTCACCACCATCCAAGCCCTCACCACAACCCCCCTCACCACCCCCCTG
TGGATCACCACCCGCCAAGCCACCACCATCCACCCCACCGACACCCCCAACCCCTACACC
GCACGCCTCTGGGGACTCGGCCAGACCGCCGCCCTCGAACACCCCCAACACTGGGGCGGG
CTCATCGACCTACCCGAACACCCCACACCCCACCACCTCCACCACCTCACCACCCACCTC
GCCACCAGCCAAGACCCCAACCCCCGACAACCCCACGAAGACCAAATCGCCATCCGCACC
CACACCACCTACGCCCGCCGACTCACCCCCACCACACCCACCACCACACCCACCCCCTGG
ACCCCACCCCCCGGCACCATCCTCATCACCGGCGGCACCGGCGCCCTCGGCACCCACATC
GCCACCTGGCTCGCCCACAAAGGCGCCAAACACCTCATCCTCACCAGCCGCCAAGGACCC
AACGCCCCCGGCGCCACCCAACTCCAACACCACCTCACCCAACTCGGCACCCACACCACC
ATCACCCCCTGCGACCTCACCGACCCCCAACAAATCGAAAACCTCATCAACCACATCAAC
ACCCACCACCCACCCCTCCAAGCCATCTTCCACACCGCCGGAACCCCCCAGACCACCCCA
CTCACCCACCTCACCCCCACCCAAGCCACCGACATCCTCAACGCCAAAACCACCGGCGCC
GAACTCCTCCACCACCACACCACCCACACCCCCCTCCACACCGTCGTCCACTTCTCCTCC
GCCGCCGCCACCTGGGGCAGCAGCGGACAATCCCTCTACGCCGCCGCCAACGCCCACCTC
GACGCCCTCGCCCAACACACCCACACCCAAGGCCAACCCACCACCTCCATCGCCTGGGGA
CTGTGGGGAGGCGGCGGGATGGGCGAGTCCCCCGAGGTCGTGGACTACTACGCCAAGCGC
GGGCTGTCGCCGATGCGGCCCGAGTCGGCCATCGAGGCCCTGGAACGCGCACTGTCGCTG
GGGGACACCTGCGTCACGGTGGCCGACGTCGACTGGAAGCGCTTCGCCGCGGGATACACC
GCCTACCGGCCCAGCCGGCTGATCTCCGACATCCCCGAGATCCGCGATCTGCAGGCGTCC
GCACCGGTCGTCGACAAGTCCGGGGAATTGACCGAGCGGCTGAACGCCGCCCTGACCCCA
CGTGAGCGGAACAAGATCCTCGTGGAACTGGTCCGTTCCGTCGCCGCCGAGGTCCTGGGG
CATGACGGCACCGACCGCATCGGCCACGACGTGGCCTTCAAGGACCTCGGCTTCGACTCG
CTGGCCGCGGTCAAGATGCGTACGAGGCTGCGCGAGACGACCGGGCTCGACCTGCCCGCG
ACGGTCATCTTCGACCACCCCACCGTGGACCGTCTCGCCGCGATGCTGCTCGCCGAGCGG
ACGGACCCGTCCGGGCCGACGGGACCGGCCGACCGCCCTGGCGCCGCGGCACCCGTCCCG
GAGCCTCGCCCCGCCGCCGACGCCGGTGAGATCGACGCGCTCAGCCCCGCGGAACTCATC
CGGCTCGCGAAGACCGGAGCCGGACAATGA
[6] KS44..417
[6] AT574..893
[6] hydroxylmalonyl-CoA or methoxymalonyl-ACP765..769
[6] KR1165..1345
[6] ACP1447..1517
[6] KS130..1251
[6] AT1720..2679
[6] hydroxylmalonyl-CoA or methoxymalonyl-ACP2293..2307
[6] KR3493..4035
[6] ACP4339..4551

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [568-696]  4.59999999999996e-67 G3DSA:3.40.366.10 [765-879]  4.59999999999996e-67 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR006162 Phosphopantetheine attachment site (PTM)
 [1475-1490]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1439-1534]  1.29999924468179e-23 SSF47336
SSF47336   ACP_like
 [1447-1520]  2.90000000000001e-22 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1447-1517]  PS50075
PS50075   ACP_DOMAIN
 [1450-1516]  1.3e-14 PF00550
PF00550   PP-binding
IPR013968 Polyketide synthase, KR (Domain)
 [1165-1344]  9.60000000000003e-61 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [44-293]  9.80000000000012e-95 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [301-417]  1.70000000000001e-47 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [574-893]  6.40000000000004e-96 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [13-37]  2.3e-09 PF08990
PF08990   Docking
 [8-44]  3.6000003870074e-08 SSF101173
SSF101173   Polyketide_synth_docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [571-874]  1.3000049540733e-62 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [698-764]  1.29999924468179e-15 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [46-305]  2.99999999999998e-89 G3DSA:3.40.47.10 [306-471]  1.5e-66 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [36-416]  5.79999653854781e-103 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1165-1379]  7.79999999999999e-38 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [206-222]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [575-873]  1.50000965748778e-107 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1448-1520]  9.30000048475975e-30 SM00823
SM00823   PKS_PP
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [46-471]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1165-1345]  1.60000240695997e-43 SM00822
SM00822   PKS_KR
SignalP
 [1-26]  0.044 Signal
Eukaryota   
TMHMM No significant hit