close all open/close all

CDS information : Nidda_00060


close this sectionLocation

Organism
StrainNRRL 2821
Entry nameNiddamycin
Contig
Start / Stop / Direction35,000 / 40,639 / + [in whole cluster]
35,000 / 40,639 / + [in contig]
Location35000..40639 [in whole cluster]
35000..40639 [in contig]
TypeCDS
Length5,640 bp (1,879 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)polyketide synthase module 7
Gene
Gene (GenBank)nidA5
EC number
Keyword
Note
Note (GenBank)
  • orf5
Reference
ACC
PmId
[9393718] Identification and characterization of the niddamycin polyketide synthase genes from Streptomyces caelestis. (J Bacteriol. , 1997)

close this sectionPKS/NRPS Module

7 malonyl-CoA
KS41..415
AT565..885
KR1212..1392
ACP1498..1568
TE1643..1856

close this sectionSequence

selected fasta
>polyketide synthase [polyketide synthase module 7]
MTRNPKMSPSIDEVLDALRTSVKETERLRRRNQELVAAAREPIAIVGMACRYPGGVSDPE
ELWQLAAEGVDAITRFPTDRGWDEAAVYSPEHRPGTTYCREGGFLAGAGDFDAAFFGISP
NEALVMDPQQRLLLETSWEALERAGVVPESLRGGRTGVFVGAAHTGYASDPARAPEGTEG
YLLTGDADAVLSGRIAYVLGLEGPAITVETACSSSLVALHLAVQSLRRGECDLALAGGVA
VMPDPTVFVEFSRQRGLAPDGRCKAFADSADGTAWAEGVGMLLVERLSDAERLGHRVLAV
VRGTAVNQDGASNGLTAPSGPAQQKVIRDALADAHLTPDDIDAVEAHGTGTPLGDPIEAG
ALLATYGHPERQTPVWLGSLKSNIGHTQAAAGIAGIIKMIQAMHHGTLPRTLHVDHPSSK
VDWKAGSLQLLAQARPWPADPDRPRRAAVSAFGVSGTNAHTIIEEPPTPAEAPERTRTLT
VLPWVLSARSEDALRDQARLLADRGGDALDIGYSLATTRAVLEHRAVTVVDDPAAAHDAL
LAVADGRPSDAVVTGIARRGRDVAFLFSGQGAQRAGAGRELYASFPVFAQALDEVAGGFD
AHLERPLLQVMFAEPGTADAALLDRTAYAQPALFAVETALFRLFESWGLMPDVLLGHSIG
GLAAAYAAGVFSSADAVRLVAARGRLMQRLPEGGAMVAVRATEQEVAELEWIAGGRAVVA
AFNGPDSLVLSGDEQAVVSAAGELAARGRRTKRLSVSHAFHSPHMDAMLADFRAVAESVT
YRTPRLPIVSEVTGRPAAPSELMDPGYWTRQIREPVRFAAAVRAARAAGAATFVELGPDA
VLSGMARECAAGDTGTAFAAALRRGRPECATVLPAAATAFVQGAHVDWAAPYEGAGARRV
DLPTYPFQHTRYWLRPAPAAARAADRTDVEEPVQSQALWAAVHDGDVKAASVQLGAEEAG
IEEPLSAVLPHLAAWHDRCRTAAETNALRYRVVWQPLPARAARRRLGGRWLVIGQDGDPL
LPDITTALHTAGADTHTLTLDPTTTDKDTLATHLTHIATAHPDGLSGILLAPTPVTPDPH
QPPLDPATTLTLTTIQALTTTPLTTPLWITTRQATTIHPTDTPNPYTARLWGLGQTAALE
HPQHWGGLIDLPEHPTPHHLHHLTTHLATSRDPNPRQPHEDQIAIRTHTTYARRLTPTTP
TTTPTPWTPPPGTILITGGTGALGTHIATWLAHKGAKHLILTSRQGPNAPGATQLQHHLT
QLGTHTTITPCDLTDPQQIENLINHINTHHPPLQAIFHTAGTPQTTPLTHLTPTQATDIL
NAKTTGAELLHHHTTHTPLHTVVHFSSAAATWGSSGQSLYAAANAHLDALAQHTHTQGQP
TTSIAWGVWGGKGMVELAPEGYLERQGVRPLRPETALAALQQALDHRDVNVTVADLDWDR
FAATLTARRPSPLISDIPQVRTARPTPRRVAAQSGPANGDRGVPRLGRARPEERRGLALH
LVRTLAAGVLGHSGAEQVDARASFRDLGFDSLAAVSLRDGLAEATGLELPAGLVFDHEDP
TALADHLSELAGRAADGASGSPAQPEGTLLAALRTAVARGRTDEAVSLMAGLAQFRPVFT
GGGRPGGLPAPVGLATGTARPRLYCCAGTAATSNPREYAHFADALRGRRDVTVLPLPGFG
DPAEPLPASLDALLADRADALLEHCGGEPFALAGHSAGANVAYALAAYLESRGSGPAAVV
LMDMYFPDDPGAMGVWRDDLLRWSLERSPVPLAEHRLTAMAGYHRLLLGSHFTALRAPVL
LARASEPLREWSGDDGPDGWRSRVPGVTSVTDVPGNHFTMLTEYAADTASAVHDWLASTV
RDNHDTPTERSPEDADVHR
selected fasta
>polyketide synthase [polyketide synthase module 7]
ATGACAAGGAACCCGAAGATGTCACCGTCCATCGACGAGGTGCTCGACGCGCTGCGTACC
TCGGTCAAGGAGACCGAGCGGCTGCGGCGGCGCAACCAGGAGCTCGTCGCCGCCGCCCGT
GAGCCGATCGCGATCGTGGGGATGGCGTGCCGCTATCCCGGCGGGGTGAGCGACCCGGAG
GAGCTGTGGCAGCTGGCCGCCGAGGGCGTCGACGCGATCACCCGCTTCCCCACCGACCGA
GGCTGGGACGAGGCCGCGGTGTACTCGCCCGAGCACCGCCCCGGCACCACCTACTGCCGC
GAGGGCGGCTTCCTCGCCGGCGCGGGTGACTTCGACGCGGCGTTCTTCGGGATCTCGCCG
AACGAGGCTCTGGTGATGGACCCCCAGCAGCGGCTGCTCCTGGAAACCTCGTGGGAGGCC
CTGGAACGCGCCGGGGTCGTGCCGGAGTCGCTGCGTGGCGGGCGGACCGGCGTGTTCGTC
GGCGCGGCACACACGGGTTACGCCTCCGACCCGGCGCGAGCGCCCGAGGGCACGGAGGGC
TACCTGCTGACCGGCGACGCCGACGCGGTGCTGTCCGGCAGGATCGCCTACGTCCTCGGC
TTGGAGGGTCCGGCCATCACCGTGGAGACGGCGTGCTCGTCGTCCCTCGTGGCCCTCCAC
CTCGCGGTGCAGTCGCTGCGGCGCGGGGAATGCGACCTGGCTCTGGCCGGGGGTGTCGCG
GTCATGCCCGACCCCACGGTGTTCGTGGAGTTCTCCCGCCAGCGCGGGCTGGCACCCGAC
GGCCGCTGCAAGGCCTTCGCCGACAGCGCCGACGGCACCGCGTGGGCCGAGGGCGTCGGC
ATGCTCCTGGTGGAGCGGTTGTCGGACGCCGAGCGGCTCGGCCACCGTGTCCTGGCCGTC
GTGCGCGGCACCGCCGTCAACCAGGACGGCGCCAGCAACGGCCTCACCGCCCCCAGCGGA
CCCGCCCAGCAGAAGGTCATCCGCGACGCCCTGGCCGACGCCCACCTCACCCCCGACGAC
ATCGACGCCGTCGAGGCCCACGGCACCGGCACCCCCCTCGGCGACCCCATCGAAGCCGGC
GCCCTGCTGGCCACCTACGGACACCCCGAGCGTCAGACACCGGTCTGGCTCGGATCGCTG
AAGTCCAACATCGGCCACACCCAGGCCGCCGCCGGCATCGCCGGAATCATCAAAATGATC
CAAGCCATGCACCACGGCACCCTGCCGCGCACCCTGCATGTCGACCATCCCAGCAGCAAG
GTCGACTGGAAGGCCGGCTCCCTCCAACTCCTCGCTCAGGCCCGGCCCTGGCCCGCCGAC
CCCGACCGGCCACGCCGCGCCGCCGTCTCCGCCTTCGGCGTCAGCGGCACCAACGCCCAC
ACCATCATCGAAGAACCACCCACCCCCGCCGAGGCACCCGAACGCACCCGCACCTTGACC
GTCCTGCCCTGGGTGCTGTCGGCTCGTTCCGAGGACGCGTTGCGTGACCAGGCGCGACTG
CTGGCCGACCGGGGCGGGGACGCCCTCGACATCGGGTACTCCCTCGCCACGACCAGGGCC
GTTCTGGAGCACCGGGCGGTCACTGTGGTGGATGATCCGGCAGCCGCGCACGACGCGCTC
CTCGCCGTGGCGGACGGGCGGCCGTCGGACGCCGTCGTGACCGGCATCGCGCGCCGGGGA
CGTGACGTGGCGTTCCTCTTCTCCGGTCAGGGCGCGCAACGAGCCGGTGCCGGACGGGAG
TTGTACGCGTCGTTCCCCGTCTTCGCGCAGGCCCTCGACGAAGTGGCGGGCGGTTTCGAC
GCCCATCTCGAACGTCCGCTGCTGCAGGTGATGTTCGCGGAGCCCGGCACGGCGGACGCC
GCCCTGCTGGACCGGACCGCTTACGCGCAGCCCGCGCTCTTCGCCGTGGAGACCGCCCTG
TTCCGGCTCTTCGAGAGCTGGGGGCTGATGCCGGACGTCCTGCTGGGCCATTCGATCGGC
GGGCTGGCCGCGGCGTACGCCGCCGGGGTGTTCTCGTCGGCGGACGCCGTCCGGCTGGTC
GCGGCGCGGGGGCGGCTGATGCAGCGGCTGCCCGAGGGCGGTGCGATGGTCGCGGTGCGC
GCCACCGAGCAGGAGGTGGCCGAGCTGGAGTGGATCGCGGGCGGAAGGGCGGTCGTCGCC
GCGTTCAACGGACCCGACTCACTCGTGCTCTCGGGGGACGAACAGGCCGTCGTGTCGGCG
GCCGGGGAACTGGCCGCCCGGGGGCGCCGTACGAAGCGGCTGTCGGTGAGCCACGCCTTC
CACTCGCCGCACATGGACGCGATGCTCGCCGACTTCCGCGCCGTCGCCGAAAGCGTCACC
TACCGCACACCGAGGCTTCCGATCGTCTCCGAGGTGACGGGACGGCCCGCCGCCCCGTCC
GAGCTCATGGACCCCGGCTACTGGACCCGCCAGATACGCGAACCGGTCCGGTTCGCCGCC
GCCGTGCGCGCCGCGCGGGCGGCCGGGGCGGCGACCTTCGTCGAACTCGGTCCCGACGCC
GTGCTGTCCGGCATGGCACGGGAGTGCGCGGCGGGCGACACCGGCACGGCGTTCGCGGCC
GCGCTGCGCCGCGGCCGCCCGGAGTGCGCGACCGTACTGCCTGCGGCGGCCACGGCCTTC
GTCCAGGGGGCCCACGTCGACTGGGCCGCGCCGTACGAGGGGGCCGGGGCGCGGCGGGTG
GACCTGCCGACGTACCCGTTCCAGCACACCCGCTACTGGCTGCGCCCGGCCCCGGCGGCG
GCACGGGCCGCGGACCGTACGGACGTGGAGGAGCCGGTCCAGTCACAGGCCCTGTGGGCA
GCGGTCCACGACGGCGACGTCAAGGCCGCCTCCGTTCAGTTGGGCGCCGAGGAGGCCGGC
ATCGAGGAGCCGCTGAGCGCGGTCCTTCCGCACCTGGCGGCCTGGCACGACCGGTGCCGC
ACCGCCGCCGAGACGAACGCGCTGCGCTACCGGGTCGTCTGGCAGCCGCTGCCGGCGAGG
GCCGCCCGGCGTCGACTCGGGGGTCGTTGGCTGGTGATCGGTCAGGACGGGGACCCCCTC
CTCCCCGACATCACCACCGCCCTGCACACCGCGGGCGCCGACACCCACACCCTCACCCTC
GACCCCACCACCACCGACAAAGACACACTCGCCACCCACCTCACCCACATCGCCACCGCC
CACCCCGACGGCCTCAGCGGCATCCTCCTCGCCCCCACCCCCGTCACACCCGACCCCCAC
CAACCCCCACTCGACCCCGCCACCACCCTCACCCTCACCACCATCCAAGCCCTCACCACA
ACCCCCCTCACCACCCCCCTGTGGATCACCACCCGCCAAGCCACCACCATCCACCCCACC
GACACCCCCAACCCCTACACCGCACGCCTCTGGGGACTCGGCCAGACCGCCGCCCTCGAA
CACCCCCAACACTGGGGCGGCCTCATCGACCTACCCGAACACCCCACACCCCACCACCTC
CACCACCTCACCACCCACCTCGCCACCAGCCGAGACCCCAACCCCCGACAACCCCACGAA
GACCAAATCGCCATCCGCACCCACACCACCTACGCTCGCCGACTCACCCCCACCACACCC
ACCACCACACCCACCCCCTGGACCCCACCCCCCGGCACCATCCTCATCACCGGCGGCACC
GGCGCCCTCGGCACCCACATCGCCACCTGGCTCGCCCACAAAGGCGCCAAACACCTCATC
CTCACCAGCCGCCAAGGACCCAACGCCCCCGGCGCCACCCAACTCCAACACCACCTCACC
CAACTCGGCACCCACACCACCATCACCCCCTGCGACCTCACCGACCCCCAACAAATCGAA
AACCTCATCAACCACATCAACACCCACCACCCACCCCTCCAAGCCATCTTCCACACCGCC
GGAACCCCACAGACCACCCCACTCACCCACCTCACCCCCACCCAAGCCACCGACATCCTC
AACGCCAAAACCACCGGCGCCGAACTCCTCCACCACCACACCACCCACACCCCCCTCCAC
ACCGTCGTCCACTTCTCCTCCGCCGCCGCCACCTGGGGCAGCAGCGGACAATCCCTCTAC
GCCGCCGCCAACGCCCACCTCGACGCCCTCGCCCAACACACCCACACCCAAGGCCAACCC
ACCACCTCCATCGCCTGGGGGGTCTGGGGTGGGAAGGGCATGGTCGAACTCGCCCCGGAG
GGCTATCTGGAGCGCCAGGGGGTGCGGCCGCTGCGGCCGGAGACGGCGCTGGCCGCGCTG
CAGCAGGCCCTCGACCACCGCGACGTCAACGTGACCGTCGCCGACCTCGACTGGGACCGG
TTCGCGGCCACCCTGACGGCGAGGCGTCCCAGCCCGCTGATCAGCGACATCCCGCAGGTC
CGCACGGCGCGCCCGACCCCCCGGCGCGTTGCCGCGCAGTCCGGTCCGGCGAACGGCGAC
CGGGGCGTGCCGCGCCTCGGGCGGGCGCGGCCCGAGGAGCGGCGTGGGCTCGCGCTGCAC
CTGGTTCGGACACTGGCCGCCGGTGTGCTCGGTCATTCCGGGGCCGAGCAGGTGGACGCG
CGGGCCTCCTTCCGCGATCTCGGCTTCGACTCACTGGCCGCGGTCAGTCTGCGGGACGGG
CTGGCCGAGGCGACCGGGCTGGAGCTGCCCGCCGGTCTGGTGTTCGACCACGAGGACCCG
ACTGCGCTGGCGGACCACCTGTCCGAGCTGGCCGGGCGCGCGGCGGACGGCGCGTCCGGG
TCGCCCGCGCAACCGGAGGGCACGCTGCTCGCCGCCCTGCGTACGGCCGTCGCCCGGGGC
CGGACCGACGAGGCGGTGTCCCTGATGGCCGGACTGGCCCAGTTCCGGCCCGTCTTCACC
GGCGGCGGACGCCCGGGCGGGCTCCCGGCGCCGGTGGGTCTCGCGACCGGGACCGCGCGG
CCGCGGCTGTACTGCTGTGCCGGCACGGCCGCCACGTCGAACCCGCGGGAGTACGCGCAT
TTCGCGGACGCCCTGCGCGGCCGCCGGGACGTGACCGTCCTGCCGCTGCCCGGCTTCGGC
GATCCGGCCGAGCCGCTGCCCGCGTCGCTGGACGCGCTGCTCGCCGACCGGGCCGACGCG
CTGCTGGAGCACTGCGGGGGCGAGCCGTTCGCCCTCGCGGGCCACTCCGCCGGCGCGAAC
GTCGCGTACGCCCTCGCCGCGTATCTGGAGTCGCGCGGCAGCGGTCCGGCGGCGGTCGTC
CTGATGGACATGTACTTCCCGGACGACCCCGGTGCGATGGGCGTATGGCGGGACGACCTG
CTGCGCTGGTCGCTGGAGCGCAGCCCGGTGCCGCTCGCGGAGCACCGGCTGACCGCCATG
GCCGGGTACCACCGGCTGCTGCTCGGCAGCCACTTCACCGCGCTGCGCGCGCCCGTGCTG
CTGGCGCGGGCCTCCGAGCCGCTGCGCGAGTGGAGCGGCGACGACGGCCCGGACGGCTGG
CGGTCCCGGGTGCCGGGGGTCACGAGCGTCACCGACGTGCCCGGCAACCACTTCACCATG
CTCACCGAGTACGCGGCGGACACGGCCTCGGCGGTCCACGACTGGCTGGCGTCCACCGTC
CGTGACAACCACGACACACCCACCGAGCGCTCCCCGGAGGACGCTGATGTACACCGATGA
[7] KS41..415
[7] AT565..885
[7] malonyl-CoA758..762
[7] KR1212..1392
[7] ACP1498..1568
[7] TE1643..1856
[7] KS121..1245
[7] AT1693..2655
[7] malonyl-CoA2272..2286
[7] KR3634..4176
[7] ACP4492..4704
[7] TE4927..5568

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001031 Thioesterase (Domain)
 [1643-1856]  8.1e-43 PF00975
PF00975   Thioesterase
IPR001227 Acyl transferase domain (Domain)
 [554-690]  7.90000000000016e-77 G3DSA:3.40.366.10 [758-873]  7.90000000000016e-77 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [1212-1378]  1.6e-53 PF00106
PF00106   adh_short
IPR009081 Acyl carrier protein-like (Domain)
 [1502-1567]  1.1e-10 PF00550
PF00550   PP-binding
 [1490-1585]  5.10001002358244e-21 SSF47336
SSF47336   ACP_like
 [1498-1568]  PS50075
PS50075   ACP_DOMAIN
 [1499-1570]  6.90000000000001e-19 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [41-290]  1.39999999999997e-96 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [298-415]  1.99999999999999e-48 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [565-885]  7.69999999999997e-63 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [562-858]  3.79997359309398e-68 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [692-757]  1.49999977583352e-16 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [43-302]  1.60000000000002e-91 G3DSA:3.40.47.10 [303-468]  2.29999999999998e-64 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [33-413]  6.10002656149838e-102 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1212-1432]  1.6e-37 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [203-219]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [566-866]  3.79997359309398e-115 SM00827
SM00827   PKS_AT
IPR020802 Polyketide synthase, thioesterase domain (Domain)
 [1644-1856]  2.19999900980707e-111 SM00824
SM00824   PKS_TE
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1499-1571]  1.39999892049878e-26 SM00823
SM00823   PKS_PP
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [43-468]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1212-1392]  4.79998722798115e-44 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit