close all open/close all
Nidda_00060 Nidda_00060   last last

CDS information : Nidda_00070


close this sectionLocation

Organism
StrainNRRL 2821
Entry nameNiddamycin
Contig
Start / Stop / Direction40,626 / 41,097 / + [in whole cluster]
40,626 / 41,097 / + [in contig]
Location40626..41097 [in whole cluster]
40626..41097 [in contig]
TypeCDS
Length472 bp (156 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
Productputative methyltransferase(fragment)
Product (GenBank)N-methyltransferase homolog
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • orf7; tylM1 homolog
Reference
ACC
PmId
[9393718] Identification and characterization of the niddamycin polyketide synthase genes from Streptomyces caelestis. (J Bacteriol. , 1997)
Related Reference
ACC
Q9ZGH6
NITE
Pikro_00100
PmId
[9770448] A gene cluster for macrolide antibiotic biosynthesis in Streptomyces venezuelae: architecture of metabolic diversity. (Proc Natl Acad Sci U S A. , 1998)
[12119032] Expression, purification, and characterization of two N,N-dimethyltransferases, tylM1 and desVI, involved in the biosynthesis of mycaminose and desosamine. (Biochemistry. , 2002)

close this sectionSequence

selected fasta
>putative methyltransferase(fragment) [N-methyltransferase homolog]
MYTDEIADVYDLVHEGKGKDYRREAEEIAALVRAERADAGSLLDVACGTGQHLRHLAGLF
DHVEGLELSPDMLRLAARRNPGVPLHQGDMRTFGLGRRFDAVVCMFSSIGHLRDTDELDA
TLERFAQHLGPGGVILVEPWWFPSRSPPVTSGRVTEA-
selected fasta
>putative methyltransferase(fragment) [N-methyltransferase homolog]
ATGTACACCGATGAGATCGCGGACGTCTACGACCTGGTGCACGAGGGGAAGGGCAAGGAC
TACCGGCGTGAGGCGGAGGAGATCGCCGCGCTGGTGCGGGCCGAGCGCGCGGACGCCGGA
TCGCTGCTCGACGTGGCCTGCGGGACCGGTCAGCACCTGCGTCACCTCGCGGGTCTCTTC
GACCACGTGGAAGGCCTCGAGCTCTCCCCCGACATGCTCCGCCTGGCGGCGCGCCGCAAC
CCCGGCGTGCCGCTGCACCAGGGCGACATGCGCACGTTCGGGCTCGGCCGGCGGTTCGAC
GCCGTGGTCTGCATGTTCAGTTCCATCGGTCACCTCCGTGACACCGACGAACTCGACGCC
ACGCTGGAGCGTTTCGCTCAGCACCTCGGCCCGGGCGGCGTGATCCTCGTCGAACCCTGG
TGGTTCCCGAGTCGTTCACCCCCGGTCACGTCGGGGCGAGTTACCGAGGCGG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit
Nidda_00060 Nidda_00060   last last