close all open/close all
first first   Niger_00020 Niger_00020

CDS information : Niger_00010


close this sectionLocation

Organism
StrainDSM 4137
Entry nameNigericin
Contig
Start / Stop / Direction1,232 / 420 / - [in whole cluster]
1,232 / 420 / - [in contig]
Locationcomplement(420..1232) [in whole cluster]
complement(420..1232) [in contig]
TypeCDS
Length813 bp (270 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
Productputative O-methyltransferase
Product (GenBank)NigE
Gene
Gene (GenBank)nigE
EC number2.1.1.-
Keyword
  • C-11
Note
Note (GenBank)
  • O-methyltransferase; ORF1
Reference
ACC
PmId
[17584617] Insights into polyether biosynthesis from analysis of the nigericin biosynthetic gene cluster in Streptomyces sp. DSM4137. (Chem Biol. , 2007)
Related Reference
ACC
Q8KI52
PmId
[12619684] Characterization of the biosynthetic gene cluster of rebeccamycin from Lechevalieria aerocolonigenes ATCC 39243. (Biosci Biotechnol Biochem. , 2003)
ACC
Q9X5Q9
PmId
[10099135] Molecular characterization and analysis of the biosynthetic gene cluster for the antitumor antibiotic mitomycin C from Streptomyces lavendulae NRRL 2564. (Chem Biol. , 1999)
[11439066] Mapping the mitomycin biosynthetic pathway by functional analysis of the MitM aziridine N-methyltransferase. (J Am Chem Soc. , 2001)
ACC
Q9S0N6
NITE
Aver_00030
PmId
[9469930] Cloning of the gene encoding avermectin B 5-O-methyltransferase in avermectin-producing Streptomyces avermitilis. (Gene. , 1998)

close this sectionSequence

selected fasta
>putative O-methyltransferase [NigE]
MTSPSAVPPGDTVSDYYSSLGPLLQMAWDDNFHFGYWDGPSDTSSVQEATDRFTDLLIER
LRVGPGDRVLDVGCGIGKPAMRVATSTGADVLGITISELQVKQAAESARLAGLSDRVAFQ
YADAMAMPFEGAAFDAVLAFESINHMDRPTALREMARVLRPGGRLVLTDVTPPSDGSYRP
DGDPGVVTSLTRLEDWPRLVDEAGLVLDELTDVTENTKDTANRMIDGILRCRREFEARHG
VSVQEVLDAAKSALPTVPSAGCAIVVAHKS
selected fasta
>putative O-methyltransferase [NigE]
ATGACATCTCCATCGGCCGTGCCGCCAGGCGACACGGTGTCGGACTACTACAGCTCGCTG
GGACCGCTTCTCCAGATGGCGTGGGACGACAACTTCCACTTCGGCTACTGGGACGGCCCG
TCGGATACCAGTTCGGTCCAGGAGGCCACCGACCGCTTCACGGATCTGCTGATCGAGCGG
CTGCGGGTGGGGCCCGGGGACCGGGTGCTGGATGTCGGATGTGGTATCGGGAAACCGGCG
ATGCGGGTGGCGACCTCCACCGGCGCCGATGTCCTGGGCATCACGATCAGTGAGCTCCAG
GTCAAACAGGCTGCCGAATCCGCCCGGCTGGCCGGGCTGTCCGACCGGGTGGCATTCCAA
TACGCCGACGCCATGGCCATGCCTTTCGAGGGTGCGGCTTTCGACGCCGTACTCGCATTC
GAATCGATCAATCACATGGACCGTCCGACCGCTCTGCGGGAGATGGCCCGTGTGCTGAGG
CCCGGAGGGCGGCTGGTGCTCACCGATGTCACTCCGCCGAGCGACGGCAGTTACCGGCCG
GACGGCGATCCCGGTGTGGTCACCTCGCTGACCCGGCTGGAGGACTGGCCGCGGCTTGTC
GATGAGGCGGGGCTGGTGCTCGACGAGTTGACCGATGTCACCGAGAACACCAAGGACACC
GCCAACCGGATGATCGACGGCATCCTGCGCTGCCGCCGGGAGTTCGAGGCGCGCCACGGG
GTCAGCGTGCAGGAGGTACTGGACGCCGCCAAGTCGGCACTGCCCACCGTGCCCAGCGCC
GGCTGCGCGATCGTGGTGGCCCACAAGTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013216 Methyltransferase type 11 (Domain)
 [70-167]  1.1e-20 PF08241
PF08241   Methyltransf_11
SignalP No significant hit
TMHMM No significant hit
first first   Niger_00020 Niger_00020