close all open/close all

CDS information : Niger_00080


close this sectionLocation

Organism
StrainDSM 4137
Entry nameNigericin
Contig
Start / Stop / Direction58,197 / 57,331 / - [in whole cluster]
58,197 / 57,331 / - [in contig]
Locationcomplement(57331..58197) [in whole cluster]
complement(57331..58197) [in contig]
TypeCDS
Length867 bp (288 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative thioesterase
Product (GenBank)NigCII
Gene
Gene (GenBank)nigCII
EC number
Keyword
  • unusual type
Note
Note (GenBank)
  • putative thioesterase; ORF2
Reference
ACC
PmId
[17584617] Insights into polyether biosynthesis from analysis of the nigericin biosynthetic gene cluster in Streptomyces sp. DSM4137. (Chem Biol. , 2007)
Related Reference
ACC
Q7WTE2
NITE
Nanch_00210
PmId
[16984884] Identification of NanE as the thioesterase for polyether chain release in nanchangmycin biosynthesis. (Chem Biol. , 2006)
[18482697] Mechanism of thioesterase-catalyzed chain release in the biosynthesis of the polyether antibiotic nanchangmycin. (Chem Biol. , 2008)
ACC
Q846Y1
NITE
Monen_00100
PmId
[12940979] Analysis of the biosynthetic gene cluster for the polyether antibiotic monensin in Streptomyces cinnamonensis and evidence for the role of monB and monC genes in oxidative cyclization. (Mol Microbiol. , 2003)
[16897798] Evidence that a novel thioesterase is responsible for polyketide chain release during biosynthesis of the polyether ionophore monensin. (Chembiochem. , 2006)

close this sectionSequence

selected fasta
>putative thioesterase [NigCII]
MDLSVPVTDDVKLHFRHRPGTASLPFLLVHGMASSARLWDEVADHLAAAGHAVYAADLRG
HGDSDTPETGYDTPTAVADLVAAAAALSLDRVVVAGHSWGGNVSVRLTAEHPELVAALAL
VDGGWLEPAKAFSSWDAFVGALRPASLEGATEQSVSDYFRAIHPDWSPAAIEAAVATMVV
NPDGSLSRRMSTEQHMSILHSIWNEPPRPWYAAIDVPTLLMPAIPKGADEKWADRIRSRI
KETTADLRHATMREYLDSEHDLHAQHPRRVADDLLDLAHCVRPAHSAR
selected fasta
>putative thioesterase [NigCII]
ATGGATCTTTCCGTGCCCGTCACCGACGATGTGAAATTGCATTTCCGGCACCGGCCGGGA
ACGGCGTCCCTTCCCTTTCTCCTGGTCCATGGCATGGCGTCGAGCGCCCGGCTGTGGGAC
GAGGTCGCCGACCATCTGGCCGCCGCGGGCCATGCGGTGTACGCGGCGGATCTGCGCGGC
CACGGGGACTCCGACACCCCGGAGACCGGATACGACACCCCGACCGCGGTCGCGGATCTG
GTGGCGGCGGCCGCCGCCCTAAGTCTTGACCGGGTGGTGGTGGCCGGTCACTCCTGGGGC
GGCAATGTCTCGGTGCGGCTGACCGCCGAGCACCCCGAACTGGTGGCCGCGCTGGCCCTC
GTGGACGGCGGCTGGCTGGAGCCGGCCAAGGCGTTCTCCTCCTGGGACGCGTTCGTCGGG
GCGTTGCGGCCGGCGTCCCTGGAGGGCGCCACCGAGCAGAGCGTGAGCGACTATTTCCGG
GCCATCCATCCGGACTGGTCCCCGGCGGCGATCGAGGCCGCGGTGGCCACGATGGTGGTC
AACCCGGACGGTTCGCTGTCCCGGCGCATGTCCACCGAACAGCACATGTCGATCCTGCAC
AGCATCTGGAACGAGCCGCCGAGGCCGTGGTACGCGGCCATCGACGTGCCCACCCTGCTG
ATGCCCGCCATTCCCAAGGGCGCGGACGAGAAGTGGGCGGACCGCATCCGCTCCCGCATC
AAGGAGACCACGGCCGACCTGCGCCACGCGACGATGCGTGAGTATCTCGACTCCGAGCAC
GATCTGCACGCCCAGCACCCACGGCGGGTGGCGGACGATCTGCTCGACCTGGCCCACTGC
GTTCGGCCCGCCCACAGCGCTCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000073 Alpha/beta hydrolase fold-1 (Domain)
 [50-65]  1e-06 PR00111 [94-107]  1e-06 PR00111 [108-121]  1e-06 PR00111
PR00111   ABHYDROLASE
IPR000639 Epoxide hydrolase-like (Family)
 [30-48]  2.19999900980708e-05 PR00412 [50-65]  2.19999900980708e-05 PR00412 [94-107]  2.19999900980708e-05 PR00412 [255-277]  2.19999900980708e-05 PR00412
PR00412   EPOXHYDRLASE
SignalP
 [1-35]  0.467 Signal
Bacteria, Gram-positive   
TMHMM No significant hit