close all open/close all

CDS information : Niger_00090


close this sectionLocation

Organism
StrainDSM 4137
Entry nameNigericin
Contig
Start / Stop / Direction58,370 / 59,629 / + [in whole cluster]
58,370 / 59,629 / + [in contig]
Location58370..59629 [in whole cluster]
58370..59629 [in contig]
TypeCDS
Length1,260 bp (419 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative cytochrome P450
Product (GenBank)NigD
Gene
Gene (GenBank)nigD
EC number
Keyword
  • C-30 hydroxylate
Note
Note (GenBank)
  • cytochrome P450 mono-oxygenase; ORF3
Reference
ACC
PmId
[17584617] Insights into polyether biosynthesis from analysis of the nigericin biosynthetic gene cluster in Streptomyces sp. DSM4137. (Chem Biol. , 2007)
Related Reference
ACC
Q846W4
NITE
Monen_00270
PmId
[8017935] Production of 26-deoxymonensins A and B by Streptomyces cinnamonensis in the presence of Metyrapone. (Appl Environ Microbiol. , 1994)
PmId
[1368213] Accumulation of grisorixin caused by treating a nigericin-producing strain with a P-450 inhibitor. (Biosci Biotechnol Biochem. , 1992)

close this sectionSequence

selected fasta
>putative cytochrome P450 [NigD]
MYPPESRFAHVENIDLTDLSFWAQPYGDRDAAFAALRRRPEPVLFQEPVMPGFGQGSGYY
AMVGHADIAEVSRRPQDFGSLPTAISIIDLPEEFNSFFGSMINMDNPQHARLRRLVSRAF
GRGMAAEFEAASHKAARKIVDDLIAKGPCDFVREVAAIMPIAVLSGMMGIPDGDYEFIYD
RSNIIVGTFDPEYVPRADQATAALLKTSHELADYIARLAADRTRNPTGDLITRLVQAQID
GERLSPEELSSFFILLVVAGMETTRNAISRGLVLLTEHPEQRKLLLSDFEAYAPGAVEEI
LRVATPINWMRRTVKRDCEVNGHRFREGEKLLLFYWSANRDESVFTDPYQFDITRDPNPH
MTFGSVGPHFCLGAHLARMEVTVLFRELFSRLPEIRTVGEPRRLVASFVEAIKHVECAF
selected fasta
>putative cytochrome P450 [NigD]
GTGTATCCCCCGGAATCCAGATTCGCCCATGTCGAGAACATCGACCTCACCGACTTGTCC
TTCTGGGCCCAGCCCTACGGCGATCGTGACGCCGCTTTCGCCGCGCTGCGCCGGCGGCCT
GAGCCCGTGCTCTTCCAGGAGCCGGTCATGCCCGGGTTCGGGCAGGGATCCGGCTATTAC
GCGATGGTCGGACACGCCGATATCGCCGAGGTGAGCAGGCGTCCACAGGACTTCGGCTCC
CTGCCCACCGCGATCAGCATCATCGATCTGCCGGAGGAGTTCAACAGCTTCTTCGGGTCG
ATGATCAATATGGACAATCCCCAGCACGCCCGGCTGCGCCGGCTGGTGTCCCGCGCGTTC
GGCCGGGGAATGGCCGCCGAGTTCGAGGCGGCCTCCCACAAGGCGGCCCGGAAGATTGTC
GACGACCTCATCGCGAAAGGGCCCTGTGACTTCGTCCGGGAGGTCGCCGCCATCATGCCG
ATCGCGGTGCTCAGCGGCATGATGGGGATTCCCGACGGCGACTACGAGTTCATTTATGAC
CGGTCCAATATCATCGTCGGCACCTTCGACCCCGAATATGTTCCGCGGGCCGATCAGGCC
ACCGCCGCCCTGCTGAAGACCTCACATGAGCTCGCCGACTACATCGCACGGCTCGCCGCC
GACCGCACCCGTAACCCCACCGGGGATCTGATCACCCGGCTGGTGCAGGCGCAGATCGAC
GGCGAGCGGCTCAGCCCCGAAGAGCTCTCGTCCTTCTTCATCCTGCTCGTCGTCGCCGGA
ATGGAGACGACCCGCAACGCCATCTCCCGCGGTCTGGTGCTGCTCACCGAGCATCCGGAG
CAACGGAAGCTGCTGCTCTCCGACTTCGAGGCATACGCACCGGGCGCGGTCGAGGAGATC
CTGCGGGTCGCGACCCCCATCAACTGGATGCGCCGGACCGTCAAGCGGGACTGCGAGGTG
AACGGCCACCGCTTCCGGGAGGGCGAGAAACTGCTGCTCTTCTACTGGTCCGCCAACCGG
GACGAGAGCGTCTTCACCGACCCCTATCAGTTCGACATCACCCGGGACCCCAATCCGCAT
ATGACCTTCGGATCGGTCGGCCCGCACTTCTGCCTGGGCGCCCATCTCGCCCGGATGGAG
GTCACGGTGCTCTTCCGCGAGCTGTTCAGCCGGCTGCCCGAGATCCGCACGGTGGGGGAG
CCCCGGCGACTGGTGGCCAGCTTCGTCGAGGCCATCAAGCATGTGGAGTGCGCTTTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [224-281]  6.70000000000001e-06 PF00067 [292-391]  7.20000000000003e-17 PF00067
PF00067   p450
 [37-419]  1.50000965748778e-80 SSF48264
SSF48264   Cytochrome_P450
 [11-418]  5.90000000000008e-97 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
IPR002397 Cytochrome P450, B-class (Family)
 [104-115]  7.20002719778969e-41 PR00359 [150-166]  7.20002719778969e-41 PR00359 [167-182]  7.20002719778969e-41 PR00359 [213-235]  7.20002719778969e-41 PR00359 [295-306]  7.20002719778969e-41 PR00359 [312-339]  7.20002719778969e-41 PR00359 [340-355]  7.20002719778969e-41 PR00359 [362-371]  7.20002719778969e-41 PR00359 [371-382]  7.20002719778969e-41 PR00359
PR00359   BP450
SignalP No significant hit
TMHMM No significant hit