close all open/close all

CDS information : Niger_00100


close this sectionLocation

Organism
StrainDSM 4137
Entry nameNigericin
Contig
Start / Stop / Direction60,043 / 59,705 / - [in whole cluster]
60,043 / 59,705 / - [in contig]
Locationcomplement(59705..60043) [in whole cluster]
complement(59705..60043) [in contig]
TypeCDS
Length339 bp (112 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)NigAXI
Gene
Gene (GenBank)nigAXI
EC number
Keyword
  • modification base
Note
  • It is proposed that this module is not involved in the extension of polyketide chain, but provides a base for modification.
Note (GenBank)
  • acyl carrier protein; ORF4
Reference
ACC
PmId
[17584617] Insights into polyether biosynthesis from analysis of the nigericin biosynthetic gene cluster in Streptomyces sp. DSM4137. (Chem Biol. , 2007)

close this sectionPKS/NRPS Module

15
ACP31..98

close this sectionSequence

selected fasta
>polyketide synthase [NigAXI]
MQTEKTETALDGAALHQALAIATAEEREDIMRETVRAQLADILAPTVVEDDSNFLENGLT
SLTALELTRNLMTLTDVEIPLVAILEYPTPAQLGHYLAEAYAAVNSGDGATA
selected fasta
>polyketide synthase [NigAXI]
ATGCAGACGGAGAAGACCGAGACCGCACTCGACGGAGCGGCGCTGCACCAGGCGCTCGCC
ATCGCCACCGCCGAGGAGCGCGAGGACATCATGCGGGAGACCGTACGGGCGCAGCTCGCC
GACATCCTGGCGCCCACCGTGGTGGAGGACGACAGCAACTTCCTGGAGAACGGGCTCACT
TCGCTGACGGCCCTCGAGCTCACCCGCAATCTGATGACGCTCACCGACGTGGAGATCCCG
CTCGTCGCCATCCTGGAGTACCCCACCCCCGCCCAGCTCGGCCACTATCTCGCCGAGGCG
TACGCCGCGGTCAACTCCGGTGACGGTGCCACGGCGTAG
[15] ACP31..98
[15] ACP91..294

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009081 Acyl carrier protein-like (Domain)
 [22-100]  4.3e-14 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [24-100]  1.69999922284049e-13 SSF47336
SSF47336   ACP_like
 [34-97]  3.5e-10 PF00550
PF00550   PP-binding
 [31-98]  PS50075
PS50075   ACP_DOMAIN
SignalP No significant hit
TMHMM No significant hit