close all open/close all

CDS information : Niger_00110


close this sectionLocation

Organism
StrainDSM 4137
Entry nameNigericin
Contig
Start / Stop / Direction64,051 / 60,152 / - [in whole cluster]
64,051 / 60,152 / - [in contig]
Locationcomplement(60152..64051) [in whole cluster]
complement(60152..64051) [in contig]
TypeCDS
Length3,900 bp (1,299 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)NigAX
Gene
Gene (GenBank)nigAX
EC number
Keyword
  • modification base
Note
  • It is proposed that this module is not involved in the extension of polyketide chain, but provides a base for modification.
Note (GenBank)
  • modular polyketide synthase; ORF5
Reference
ACC
PmId
[17584617] Insights into polyether biosynthesis from analysis of the nigericin biosynthetic gene cluster in Streptomyces sp. DSM4137. (Chem Biol. , 2007)

close this sectionPKS/NRPS Module

15
KS34..410
at620..669
KR1048..1221

close this sectionSequence

selected fasta
>polyketide synthase [NigAX]
MSNEEKLVDYLKWTTAELSETRKRLRELQADLEEPIAIVGMACRFPGGVRTPAQLWDLVA
DERDAVSSFPTDRGWDLENLYHPDPDHHGTSYVRAGGFIHDAADFDAEFFGIGAREAAAV
EPQQRMLLELAWEAAENAGIDPHTLRGSRTGVYTGVMYHDYASRLDEIPEGLLGHVGNGN
AGSVSSGRVAFTLGLQGAAVSLDTACSSSLVAMHLAAGALRRGECTLALAGGAAIMYTAS
VFQVASSQRQLSPDVRCRSFADAADGMVYGEGAGLVLLERLSDARRNGHPVSAVIRGSAI
NQDGASTGMAAPNGPAQQQLVRDALANARLSTGDVDAVEAHGTGTAFGDSIELQALLATY
GQDRPEDRPLLLGSIKSNIGHTQAAAGMAGVIKMVMAMRRGVLPRSLHIDRPTRLVRWRK
GAVRLLTERMDWPLVDRPRRAGVSSFSASGTNAHVILEEFTEVPDGADDRGARDPGVVPW
VLSARSAAALRGQARALAAHTAAGPGLSPADVGWSLVTTRSAFDHRAVVVGRGPDELRAG
LAALAAGAPHPAVVGPEVSRTGAEAAPAGGAVFAFGGEGGHPPGTGAELYGRFPVFATAM
DEVGELLGVKGERDASSRAGLFALHIALARLLASVGVRPDAVVGRGVGEIAAAHFAGALD
LADACRLVAADTDPDTVEYERLPCPSLDEAGAVWELGPQAMLPSAPAALVLSPFRGEGSE
VRELLRGLARMHTMGATVDWAALFDGDPAPRTVALPTYAFQRQRYWLENEAPADAVPTVE
TWADAEFWDAVAGTDTAALTRALEVPAERREALAELLPALATWRRQREWRYRIVWKPLPD
PPAPRLTGTWLVVTSGDDEDDTTVAAVATALRDHGAETVVCPLDTTVPDGEARARRMSEA
VAGRLVAGVLSLLALDGGGTPDDDGRGPALAPTVELFETLRRAGVEAPVWPATRGGVTVH
LGDPMSRPEQARFWGLGGALAMEQPHRWGGLVDLPERLDDRAGRRLAAVLTGAYGEVEVA
VRGHGRFARRLVRDVPVAPTAPARRLRGTVLITGAATALAAHTARWAAGDGAEHLLLIDT
APPAADLAAELSASGVRVSVATVDVADAEALAAAVAGIPAEFPLTAVLHLTAPLAAEAGQ
LEMARIEREWAATVAGAVNLCALGSDHELSALVLGCSVVGVLPSPGLGNQAPAHAYLSAL
AQECRARGVPATSVCWGSIDDPDTAAGAAKQLRTNGMPALPERSAAALLRQAVMADTASV
VIADIDWTWMAAHASELGTPRLFEDLSGPTATPHTHRGR
selected fasta
>polyketide synthase [NigAX]
ATGAGCAACGAGGAAAAGCTCGTCGACTATCTGAAGTGGACCACGGCCGAGCTCTCCGAG
ACCCGGAAGCGGCTGCGGGAGCTCCAGGCGGACCTGGAAGAGCCCATCGCCATCGTCGGC
ATGGCCTGCCGCTTTCCGGGCGGTGTGCGCACCCCGGCACAGCTGTGGGACCTGGTGGCC
GACGAGCGGGACGCCGTCTCCAGCTTCCCCACCGACCGGGGCTGGGACCTGGAGAACCTC
TACCACCCCGATCCGGACCACCATGGCACCTCGTACGTACGGGCCGGCGGCTTCATCCAT
GACGCGGCCGACTTCGACGCGGAGTTCTTCGGCATCGGCGCCCGGGAGGCGGCGGCCGTC
GAACCGCAGCAGCGGATGCTGCTGGAGCTGGCCTGGGAGGCGGCGGAGAACGCGGGCATC
GATCCGCACACCCTGCGGGGCAGCCGGACCGGTGTCTACACGGGGGTGATGTACCACGAC
TACGCCTCGCGTCTGGACGAGATCCCCGAGGGTCTGCTGGGCCATGTGGGCAACGGCAAC
GCGGGCAGTGTGTCCTCGGGCCGGGTGGCGTTCACCCTGGGTCTCCAGGGCGCGGCGGTC
TCCTTGGACACCGCGTGTTCGTCGTCGCTGGTGGCGATGCATCTGGCGGCCGGGGCGCTG
CGGCGGGGCGAGTGCACGCTGGCGCTGGCCGGTGGCGCCGCCATCATGTACACCGCGAGC
GTGTTCCAAGTGGCCTCCAGTCAGCGTCAGTTGTCCCCCGATGTGCGGTGCCGGTCGTTC
GCGGACGCCGCCGACGGCATGGTGTACGGCGAGGGCGCCGGGCTGGTGCTGCTGGAGCGG
CTCTCCGACGCGCGGCGCAACGGCCACCCCGTATCGGCCGTGATCCGTGGCTCGGCGATC
AACCAGGACGGTGCCAGTACGGGCATGGCCGCGCCGAACGGCCCCGCCCAGCAACAGCTG
GTCCGTGACGCCCTGGCGAACGCCCGGCTGTCCACGGGGGACGTGGACGCGGTGGAGGCG
CATGGCACCGGTACCGCGTTCGGCGATTCCATCGAGCTCCAGGCGCTGCTCGCCACGTAC
GGCCAGGACCGTCCCGAGGACCGGCCGCTGCTGTTGGGGTCGATCAAGTCGAACATCGGT
CATACACAGGCCGCCGCCGGAATGGCCGGTGTGATCAAGATGGTGATGGCGATGCGCCGG
GGTGTGCTGCCGCGTTCGCTCCATATCGACCGGCCGACCCGGCTGGTGCGCTGGCGCAAG
GGGGCGGTGCGGCTGCTGACCGAGCGGATGGACTGGCCGCTGGTGGACCGGCCACGGCGG
GCCGGTGTCTCGTCGTTCAGCGCCAGTGGCACCAACGCCCATGTGATTCTGGAGGAGTTC
ACCGAAGTGCCGGACGGCGCCGACGACAGGGGCGCCCGCGACCCGGGCGTGGTGCCGTGG
GTGCTGTCCGCGCGGAGCGCGGCGGCGCTGCGCGGCCAGGCCCGTGCGCTGGCCGCGCAT
ACGGCGGCCGGTCCGGGGCTCTCCCCCGCCGATGTGGGCTGGTCGCTGGTGACCACACGG
TCGGCTTTCGACCACCGGGCCGTCGTGGTCGGCCGGGGACCGGACGAGCTGAGGGCGGGG
CTGGCGGCGCTGGCGGCCGGTGCACCGCACCCCGCGGTGGTGGGGCCCGAGGTGTCCCGT
ACCGGCGCGGAGGCGGCCCCCGCGGGCGGGGCGGTGTTCGCCTTCGGTGGCGAGGGCGGT
CATCCGCCGGGGACGGGCGCCGAACTGTACGGTCGGTTCCCGGTCTTCGCCACGGCCATG
GACGAGGTCGGCGAGCTGCTCGGGGTGAAGGGGGAGCGCGACGCGTCCTCCCGGGCGGGG
CTGTTCGCCCTCCATATCGCGCTCGCCCGGCTGCTGGCCTCGGTGGGGGTGCGTCCCGAC
GCGGTGGTGGGCCGTGGGGTCGGTGAGATCGCGGCGGCGCATTTCGCCGGTGCTCTCGAC
CTCGCGGACGCCTGCCGGCTGGTCGCCGCCGACACCGATCCGGACACGGTGGAGTACGAA
CGCCTGCCCTGCCCTTCGCTCGACGAGGCCGGTGCGGTGTGGGAGTTGGGGCCCCAGGCG
ATGCTGCCCTCCGCTCCTGCGGCGCTGGTGCTCTCGCCCTTCCGGGGCGAGGGGTCCGAG
GTGCGCGAGTTGCTGCGTGGCCTGGCCCGTATGCACACCATGGGCGCCACCGTGGACTGG
GCGGCCCTGTTCGACGGCGATCCGGCTCCCCGTACCGTCGCACTGCCCACCTACGCCTTT
CAGCGACAGCGCTACTGGCTGGAGAACGAGGCTCCGGCGGATGCGGTGCCCACGGTGGAG
ACCTGGGCGGACGCCGAGTTCTGGGATGCCGTGGCGGGTACGGACACGGCGGCTCTGACC
CGGGCGCTGGAAGTCCCCGCCGAACGGCGGGAGGCGCTCGCGGAACTCCTGCCCGCCCTG
GCCACCTGGCGGCGGCAGCGGGAGTGGCGCTACCGCATCGTATGGAAGCCCCTCCCCGAC
CCTCCGGCGCCACGGCTGACCGGCACCTGGCTGGTGGTGACGTCCGGCGACGACGAGGAT
GACACCACGGTGGCCGCCGTGGCCACGGCGCTGCGCGACCATGGCGCCGAGACCGTCGTG
TGCCCCCTGGACACCACAGTGCCGGACGGCGAGGCGCGGGCCCGGCGGATGTCCGAGGCC
GTCGCCGGGCGGCTGGTCGCGGGGGTGCTCTCGCTGCTGGCGCTGGACGGCGGCGGGACA
CCGGACGACGACGGACGGGGCCCGGCGCTCGCCCCGACCGTCGAGTTGTTCGAGACGCTG
CGGCGGGCCGGGGTCGAGGCCCCGGTGTGGCCGGCCACCCGCGGTGGCGTCACCGTCCAT
CTGGGCGATCCGATGTCCCGTCCCGAGCAGGCCCGGTTCTGGGGTCTGGGCGGTGCGCTG
GCGATGGAGCAGCCGCACCGGTGGGGCGGGCTGGTCGACCTGCCGGAGCGGTTGGACGAC
CGGGCGGGGCGGCGGCTCGCGGCGGTCCTGACCGGTGCGTACGGCGAGGTGGAGGTGGCC
GTGCGCGGCCACGGCCGCTTCGCCCGGCGTCTGGTACGCGATGTCCCCGTGGCCCCCACC
GCCCCCGCCCGGCGGCTCCGGGGCACGGTCCTCATCACGGGCGCCGCCACCGCGCTGGCC
GCGCATACCGCCCGTTGGGCGGCCGGGGACGGCGCCGAACACCTTCTGCTCATCGACACC
GCGCCACCGGCCGCCGACCTGGCGGCCGAGCTGAGCGCCTCGGGTGTACGGGTGTCCGTG
GCCACCGTCGATGTGGCGGACGCGGAGGCGCTTGCCGCGGCCGTCGCGGGCATTCCCGCG
GAGTTCCCGCTGACGGCCGTCCTGCACCTCACGGCGCCTCTTGCCGCCGAGGCGGGGCAG
CTGGAGATGGCGCGGATCGAGCGCGAATGGGCGGCGACGGTGGCGGGCGCGGTGAACCTC
TGCGCGCTGGGGAGCGACCACGAGCTGTCGGCCCTGGTGCTCGGGTGCTCGGTCGTGGGC
GTCCTGCCCAGCCCGGGACTGGGCAACCAGGCGCCGGCCCACGCCTATCTGAGCGCGCTC
GCCCAGGAGTGCCGGGCCCGGGGCGTTCCGGCGACCTCGGTGTGCTGGGGCTCGATCGAC
GATCCCGACACTGCCGCCGGCGCCGCCAAGCAGCTCCGGACCAACGGGATGCCTGCGCTG
CCCGAGCGCTCGGCCGCCGCCCTGCTGCGGCAGGCCGTCATGGCGGACACGGCGTCCGTG
GTGATCGCGGACATCGACTGGACCTGGATGGCCGCACACGCCTCCGAGCTGGGAACACCT
CGGCTCTTCGAGGACCTTTCCGGCCCCACGGCCACGCCGCATACGCACCGCGGTCGGTGA
[15] KS34..410
[15] at620..669
[15] KR1048..1221
[15] KS100..1230
[15] at1858..2007
[15] KR3142..3663

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [564-669]  9.20000000000002e-22 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR013968 Polyketide synthase, KR (Domain)
 [1048-1221]  4.10000000000001e-32 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [34-284]  4.09999999999995e-86 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [293-410]  1.2e-44 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [620-669]  7.20000000000001e-11 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [1-27]  6.50000000000001e-14 PF08990
PF08990   Docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [570-670]  5.20000089003336e-20 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016038 Thiolase-like, subgroup (Domain)
 [33-295]  8.70000000000003e-81 G3DSA:3.40.47.10 [296-461]  1.80000000000002e-59 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [26-408]  8.29994113369276e-96 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1048-1227]  1.4e-19 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [36-462]  SM00825
SM00825   PKS_KS
SignalP No significant hit
TMHMM No significant hit