close all open/close all

CDS information : Niger_00120


close this sectionLocation

Organism
StrainDSM 4137
Entry nameNigericin
Contig
Start / Stop / Direction65,478 / 64,048 / - [in whole cluster]
65,478 / 64,048 / - [in contig]
Locationcomplement(64048..65478) [in whole cluster]
complement(64048..65478) [in contig]
TypeCDS
Length1,431 bp (476 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative epoxidase
Product (GenBank)NigCI
Gene
Gene (GenBank)nigCI
EC number
Keyword
Note
Note (GenBank)
  • epoxidase; ORF6
Reference
ACC
PmId
[17584617] Insights into polyether biosynthesis from analysis of the nigericin biosynthetic gene cluster in Streptomyces sp. DSM4137. (Chem Biol. , 2007)
Related Reference
ACC
Q846W9
NITE
Monen_00220
PmId
[12940979] Analysis of the biosynthetic gene cluster for the polyether antibiotic monensin in Streptomyces cinnamonensis and evidence for the role of monB and monC genes in oxidative cyclization. (Mol Microbiol. , 2003)

close this sectionSequence

selected fasta
>putative epoxidase [NigCI]
MTEPKHGVVLGGGWAGMLAAHVLARHLERVTVVERDVLPDGPRHRKGSPQGRHVHVLWSS
GARIVDTLLPGMIDQLLDAGARRIGFHQDLVTLTSHGWQHRFPPRQYALMCTRPFLDWKV
RDRVLATGRITLRQRAEILDLAGDAKRVTGVRVRDMGSGAAETLAADLVIDASGRGSRLR
HWLSALDVPPLEEDIVDAGIAYATRVYQGPPGAAAGFPAVNVAADHRLREPGRFGVVYPQ
EDLTWMVTLSCTRGAGLPTHDDEFLPYARTLRHPLVADLIALAKPLTSVAVSRVGANRRL
YPERLDIWPEGLLVLGDALAAFNPIYGHGMSSAARAAAALDTELQRSGTAEGTTRRAQQA
ISATVDDPWIMAASKDVEYVNCRMNTTDPRLTGGAVARQRFSDLIADRSIRSSAVCDVVT
DVISLTAPQSELASSGFLSLMHKDRVLPELTEPPLTADELALVNLSPRSAVSAGGS
selected fasta
>putative epoxidase [NigCI]
ATGACCGAACCCAAACACGGAGTCGTTCTGGGCGGAGGCTGGGCGGGAATGCTGGCTGCC
CATGTGCTGGCCCGCCATCTGGAGCGCGTCACCGTCGTGGAGCGCGATGTGCTGCCGGAC
GGCCCCCGGCACCGCAAGGGATCGCCGCAGGGGCGCCATGTGCATGTGCTGTGGTCCAGC
GGTGCGCGCATCGTGGACACGCTGCTGCCGGGCATGATCGACCAGTTGCTCGACGCGGGC
GCCCGCCGGATCGGTTTCCATCAGGACCTGGTGACCTTGACGTCCCACGGCTGGCAGCAC
CGCTTTCCACCGCGGCAGTACGCGCTGATGTGTACCCGCCCGTTTCTGGACTGGAAGGTC
CGTGACCGCGTTCTGGCCACCGGGCGGATCACCCTGCGCCAGCGCGCCGAGATCCTCGAT
CTGGCCGGCGACGCCAAACGGGTCACCGGGGTCCGGGTGCGCGACATGGGCAGCGGTGCG
GCGGAAACGCTGGCGGCCGATCTGGTGATCGACGCCTCGGGGCGCGGTTCCCGGCTCAGG
CACTGGCTGTCGGCGCTTGATGTGCCGCCGCTGGAGGAGGACATCGTCGACGCGGGCATC
GCGTACGCCACCCGCGTGTACCAGGGGCCGCCGGGTGCCGCCGCCGGGTTCCCTGCCGTC
AACGTGGCCGCCGACCACCGGCTGCGCGAGCCGGGCCGGTTCGGGGTGGTGTATCCGCAG
GAGGACCTCACCTGGATGGTGACCCTGTCGTGCACCCGGGGCGCCGGGCTGCCCACCCAC
GACGACGAGTTTCTGCCCTACGCCCGGACGCTGCGCCATCCGCTGGTCGCGGATCTCATC
GCGCTGGCGAAGCCGCTGACCTCGGTGGCCGTCTCGCGGGTCGGCGCCAACCGGCGGCTG
TATCCGGAGCGGCTGGACATCTGGCCGGAGGGGCTGCTGGTGCTCGGGGACGCGCTGGCC
GCGTTCAACCCGATCTACGGCCATGGCATGAGCTCCGCGGCTCGCGCGGCCGCCGCGCTG
GACACCGAGCTCCAGCGGTCCGGAACCGCCGAGGGGACGACCCGCCGGGCGCAGCAGGCG
ATCAGCGCCACCGTGGACGACCCGTGGATCATGGCCGCGTCCAAGGACGTGGAGTATGTC
AACTGCCGGATGAACACGACGGATCCGCGGCTGACCGGCGGGGCCGTGGCGCGGCAGCGG
TTCTCCGATCTGATCGCCGACCGGTCGATCCGCTCCTCGGCGGTGTGTGATGTGGTCACC
GATGTCATCAGCCTGACCGCGCCGCAGTCCGAGCTGGCGTCCAGCGGCTTTCTGTCGCTG
ATGCACAAGGACCGGGTCCTTCCGGAGCTCACCGAGCCACCGCTGACCGCCGATGAGCTC
GCGCTGGTGAACCTGAGTCCGCGCAGCGCGGTGAGTGCGGGCGGCTCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP
 [1-24]  0.928 Signal
Eukaryota   
TMHMM No significant hit