close all open/close all

CDS information : Niger_00140


close this sectionLocation

Organism
StrainDSM 4137
Entry nameNigericin
Contig
Start / Stop / Direction66,453 / 66,016 / - [in whole cluster]
66,453 / 66,016 / - [in contig]
Locationcomplement(66016..66453) [in whole cluster]
complement(66016..66453) [in contig]
TypeCDS
Length438 bp (145 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative epoxide hydrolase/cyclase
Product (GenBank)NigBI
Gene
Gene (GenBank)nigBI
EC number
Keyword
Note
  • Belongs to polyether epoxide hydrolase(PEH)-B group.
Note (GenBank)
  • cyclase; ORF8
Reference
ACC
PmId
[17584617] Insights into polyether biosynthesis from analysis of the nigericin biosynthetic gene cluster in Streptomyces sp. DSM4137. (Chem Biol. , 2007)
Related Reference
ACC
Q846W7
NITE
Monen_00240
PmId
[16632258] Evidence for the role of the monB genes in polyether ring formation during monensin biosynthesis. (Chem Biol. , 2006)
ACC
B6ZK72
NITE
Lasal_00210
PmId
[18710235] Epoxide hydrolase Lsd19 for polyether formation in the biosynthesis of lasalocid A: direct experimental evidence on polyene-polyepoxide hypothesis in polyether biosynthesis. (J Am Chem Soc. , 2008)
[21375229] Enzymatic epoxide-opening cascades catalyzed by a pair of epoxide hydrolases in the ionophore polyether biosynthesis. (Org Lett. , 2011)
[22388816] Enzymatic catalysis of anti-Baldwin ring closure in polyether biosynthesis. (Nature. , 2012)

close this sectionSequence

selected fasta
>putative epoxide hydrolase/cyclase [NigBI]
MIDERSRKKLILEHSRRMNAADVDGLLELYADEVTFEDPVGSGRRTGRDALRAHFEELAA
AGIAEIPGEPVAGQDGVHVLVPVTATMDYLPKGPGFAERGWLAAPDTPESSRITWDYVLM
MRAGAGGLIQELQMFWGRSDIAIAG
selected fasta
>putative epoxide hydrolase/cyclase [NigBI]
GTGATTGATGAGCGAAGCCGGAAGAAGCTCATTCTCGAGCACAGCCGCCGGATGAACGCC
GCGGATGTCGATGGACTTCTCGAACTCTACGCGGACGAGGTCACCTTCGAGGATCCGGTC
GGATCGGGGCGCCGGACCGGGCGGGACGCCCTTCGTGCGCATTTCGAGGAGCTCGCCGCG
GCGGGTATCGCCGAGATTCCCGGTGAGCCGGTCGCGGGGCAGGACGGTGTGCATGTCCTG
GTGCCGGTGACGGCCACCATGGACTATCTGCCCAAGGGTCCCGGTTTCGCCGAGCGCGGC
TGGCTGGCGGCCCCGGACACCCCGGAGAGCTCCCGTATCACCTGGGACTACGTGCTGATG
ATGCGCGCGGGGGCCGGTGGCCTCATTCAGGAACTCCAGATGTTCTGGGGGAGGTCGGAC
ATTGCTATCGCCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009959 Polyketide cyclase SnoaL-like domain (Domain)
 [16-131]  7.20000000000001e-12 PF12680
PF12680   SnoaL_2
SignalP
 [1-20]  0.078 Signal
Bacteria, Gram-negative   
TMHMM No significant hit