close all open/close all

CDS information : Niger_00170


close this sectionLocation

Organism
StrainDSM 4137
Entry nameNigericin
Contig
Start / Stop / Direction93,358 / 78,995 / - [in whole cluster]
93,358 / 78,995 / - [in contig]
Locationcomplement(78995..93358) [in whole cluster]
complement(78995..93358) [in contig]
TypeCDS
Length14,364 bp (4,787 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)NigAVII
Gene
Gene (GenBank)nigAVII
EC number
Keyword
Note
Note (GenBank)
  • modular polyketide synthase; ORFG
Reference
ACC
PmId
[17584617] Insights into polyether biosynthesis from analysis of the nigericin biosynthetic gene cluster in Streptomyces sp. DSM4137. (Chem Biol. , 2007)

close this sectionPKS/NRPS Module

10 malonyl-CoA
11 malonyl-CoA
12 malonyl-CoA
KS35..411
AT576..904
KR1225..1404
ACP1505..1575
KS1596..1973
AT2144..2472
KR2791..2970
ACP3072..3142
KS3163..3540
AT3695..4022
KR4344..4523
ACP4627..4697

close this sectionSequence

selected fasta
>polyketide synthase [NigAVII]
MAGNEEKLLDYLKRVTADLRQTQRRLKDVESAGYEPVAIVGMSCRFPGGVRSPEELWELV
AAERDAISELPTDRNWDVENLFHPDPEHPGTSYTCEGGFIDDPAGFDAAFFGISPREALG
MAPQQRLALEASWEAIEHAGVDPESLRGSRTGTFIGCDHLDYCSDASQVPEGSAGYFTIG
NSASVVSGRVAYTLGLEGAAVTVDTACSSSLVAMHLACQAIRQGECDMALAGGVAVMSST
APFIGFSELRGLAPDGRSKAFSANSDGMTLAEGVGVLLLERLADARRNGHQVLAVVRGTA
VNQDGASNGLTAPNGPSQQRVIRQALANARLSPSDVDAVEAHGTGTTLGDPIEAQALLAT
YGQERPEGRPLWLGSIKSNIGHAQMAAGAAGVIKMVMAMRHEVLPASLHIDEPTPHVDWS
AGDIHLLTEAREWPRGEHPRRAGISSFGISGTNAHVIVEQAPEEPPAAVGAGAGEPVEPV
EPVGGPVPWVVSARGAEALRGQARALAARVNADPGVSADEVGWSLLRSRTLFDHRAVVIG
QNREELVSGLEALAAGEPHPGVVEAGKAAEVAGQTVFLFSGQGSQRPGMGAELYNRFPIF
AEAFDEVCALLDPHLEHPLRELVFSREPEQAALLDHTTYAQTGLFALHIALARLLDSLGV
RPDTVIGHSIGEIAAAHIAGIFDLPDACHLVATRATLMGGLREGGGMATIAATPDELAED
LARYDGQVGIAALNTPGNTVISGPTDLVTDISVTWAAKGRKTRTLTVSHAFHSSLMDPIL
EPFKEAISGLTYHPPTIPLISNLTGQPADEHITTPDYWAQHIRQPVHFHPAITHIAPETG
IFLELGPDPTLTTATHHTLHHHTSTEQNPTNQPTPLITPALTRKQPEWQALTHALARLHT
AGVEIDWTSWFPADPAPRVVGLPTYAFQHQRFWLAPPAARTSFEGTAGDPAEARLWHAIE
ELDVDALSSTLRLEKDSPGIDALLPALPVLSTWRRQHRERSTIDSWRYRATWQQLPDPPT
PTLTGTWLVVVPAGQEEHATVQVTVQALRAHGATALRHGVNAHDIDRAALHERLARLTEE
FQPAGVISLLALDTEPLIGHSAVPAGLGATTALLQALDDAGIGTPLWCLTQGAVATGRGD
LLPHPGQSQIWGFGRVAALEYPQRWGGLIDLPTTMTHHTAGRLAALLVPGQPEDQVAIRT
TGTYARRLARVPAADTAPASWEPSGTTLITGGTGGLGAQIARWLAHRGAPRLHLISRSGP
DAPGASELGEELTALGTDTTITACDASDRAALQRLIDTVPAEHPLTAVFHTAGTMELGQI
GELEPGRLQSVLRSKALAAAHLHDLTQDLDLAAFVLFSSNAATWGSGQQAAYAAANTYLD
ALAEHRRARGLPATSLAWGPWGEAGMAADQHTLSHLKRRGLSPLPTDLAIASLHQALTHD
DTAVTIADVDWETFGRTFTAQRPSPFLTRLLPTSAEPTTPAATADDNPLRQQLGAAPTAQ
RHQILVRHIQTLAATILGHPGAGRDSPGQPSRRLGFDSLTAVELRNQLAASTGLSLAPAL
VFDHPTPNALATYLGAELTGQRATVATHTSSVATDDEPIAIVGMACRYPGGVRSPEELWK
LVAAGRDAIGEMPTDRDWDLDTLFDPDPERLGTTYAREGGFLHDAAGFDAAFFGISPREA
LAMDPQQRLLLETAWETFESAGLDRDTLAGSNTGVFAGGTYQGYGASGSSSAREVEGYLL
AGGTPSVMSGRVAYAFGLEGPAVTVDTACSSSLVAMHLAAQALRQGECTMALAGGVTVMA
TPTTFVEFSRQRGLAADGRCKPFALAADGTGWGEGAGLLLLERLSDARRNGHRVLAVIRG
SAVNQDGTSNGLTAPNGPSQQRVIGQALTNARVSPTEVDAVEGHGTGTTLGDPIEAQALL
ATYGRERPEGRPLWLGSIKSNIGHTQAASGVAGVIKMVMAMRHEVLPASLHIDEPTPHVD
WSAGDVQLLAEAREWPRGEHPRRAGISSFGISGTNAHVIVEQAPEEPPAAVGADAGEPVE
PVERAESVEPVGGPVPWVVSARGAEALRGQVRALAARVYADPGVSADEVGWSLLRSRTLF
DHRAVIIGQNREELTAGLEALAAGEPHPGLVEPGEATDTTGKTVFLFSGQGSQRPGMGAE
LYNRFPIFAEAFDEVCALLDPHLEHPLRQVVFDTSAEHAGLLDHTTYAQAGLFALHIALA
RLLDSVGVRPDTVIGHSIGEIAAAHIAGIFDLPDACHLVATRATLMGQLPQGGSMATIAA
TPDELANDLAQHAGQVSIAVLNTPTNTVISGPTELITNISTTWAAKGRKTRTLTVSHAFH
SPLMDPILEPFKEAISGLTYHPPTIPLISNLTGQPADEHITTPDYWAQHIRQPVHFHPAI
THTAPHTSTFLELGPDPTLTTATHHTLHHHTSTEQNPTNQLTPLITSTLTRKQPERQALT
HALARLHTAGVEIDWTSWYPATPTPRTIDLPTYAFQHQHYWLSSAPSSSPTPTEAALVDR
KFWEAVEREDLEALAATIDSPADQQPMLSAVLPTLSAWRRHHREQSVINSWRYQIAWKRL
SAPSTPPDLSGTWLLIIPAGQSDHPAVETVAHALTTHGATPIRHMLDTHTVDRDALADHL
TRLAMQGEPAGVLSLLALDEEPHPEYAAVPSGLAATTVLLQALGDAEIPAPLWCLTQGAV
ATGPGDPLPSPRQAQTWGLGRAAALEHPRRWGGLIDLPAVIDHHTADRLAALLTPGRPED
QTAIRATGSYARRLRKATAPTAAPRTWQPTGTTLITGGTGGLGAHVARWLARLGAPHLHL
ISRSGPDAPGASQLTQELIDLGTAVTITACDASDRAALQRLLDTIPAEHPLTTVIHAAGT
SDTELLADLGPERLEHVLGPKALAAAHLHELTQELDLSAFVLFSSGAAAWGGSRQGAYAA
ANTYLDALAEHRRARGLPATSLAWGPWGDAGMAADETALAFYGRRGLSPLSPELAVASLQ
HALDHRDTTITVADIDWEKFPAAFTAQRPSPLLDDLITAIESPAEPITGASTGTSLQQRL
SAGTPEQQHQLLLERIQSLAASILGHSGPDAIPPAQPFQELGFDSLTAVELRNQLATATG
IDLAPALVFDHPTPNALATYLRAELTGQQTAVAAHSPTTAAQDEPIAIVGMACRYPGDAH
SPQDLWELVIAHRDAIAQMPTDRNWDLDALYDPDPDRAGTSYVREGGFLRHAAEFDPAFF
GISPREAIAMDPQQRLLLETAWETFESAGLDRDTLAGSNTGVFAGVTSQDYLSLTGDTAS
DVEGYVATGNIGSVVSGRVAYSFGLEGPAVTVDTACSSSLVAMHLAAQALRQGECTMALA
GGVTVMATPGAFIEFSRQRGLAPDARCKPFAAAADGMVWGEGVGLVLLERLSDARRNGHR
VLAVVRGSAVNQDGTSNGLTAPNGPSQQRVIRQALANARLSPSDVDAVEAHGTGTTLGDP
IEAQALLATYGQERPEGHPLWLGSIKSNIGHTQAAAGVAGVIKMVMAMRHELLPASLHID
EPSPNVDWNAGDLRLLAETVPWPQGDRARRAGVSSFGISGTNAHLILEQAPEPAEPAPVS
NIAGVVPWVVSAQSDAALRGQARALAGHIIGDPEVSAGEVGWSLLRSRTLFDHRAVVIGQ
NREELTAGLEALAAGEPHPGLVEPGEATDTTGKTVFLFSGQGSQRPGMGTELYNRFPIFA
EAFDEVCALLDPHLEHPLRQVVFSREPEQATLLDHTTYAQAGLFALHIALARLLDSVGVR
PDTVIGHSIGEIAAAHIAGIFDLPDACHLVATRATLMGQLPQGGGMATIGATPEELAEDL
ARYDGQVSIAALNTPTNTVISGPTNLVTDVSATWAAKGRKTRTLTVSHAFHSPLMDPILE
PFKEAISGLTYHPPTIPLISNLTGQPADEHITTPDYWAQHIRQPVHFHPAITHTAPHTST
FLELGPDPTLATATHHTLHHHTSTEQNPTNQPTPLITSTLTHKRPDTHALTHTLAQLHTS
GTTIDWTSWYPAIPTPRTIDLPTYAFQHQHYWLAPPTPRADSRLNGHNPAEARLWDAIEE
LDVDALASTLDLEKDSPGVGALLPALPVLSTWRRRHRERSTIDSWRYRVAWKQVRDPATA
PTLSGTWLLLVPTGLEEHAAVHATVEALDAHGAAHEVLSIDGADARRDAIAPLLSQLPDG
STPEGILSLLALDRTPHPDHPAVPTGLAATAALVQALGEAPLIAPLWCVTQGAVATNAAD
PLPHPHQAQIWGMGRVAALEHPRLWGGLIDLPAVADARTPARIAAMLVPGQPEDQVAIRS
TVLARRLEGAVCPDTAPTAWRPAGTTLITGGTGGLGAHVARWLARQGAPHLHLVSRSGPD
APGAAQLAQDLDDLGATITITACDVSDRAALQRLLDTIPAEHPLTAVVHAAGLPENTPLA
ELDLPGIDAVLRPKALAAALLHELTEELDLSAFVLFSSGAAAWGGGRQPSYAAANAYLDA
LAEHRRARGLAATSLAWAPWSDAGMASDEAAVDYYRRRGMRPLDTDLAIASLQHALDHGD
TTITIADIDWERFPAGFTAQRPSPLLSDLAAAASPGPDAAPDATAAMSGSLQRQLATGTL
AQRHQLLLHHIQTHAAAILGHPTIDAIPPAQPFQELGFDSLTAVEFGHRLSAATGVDLPP
TLVFDHPTPKELADYLRERLVEGEPTSEGHLLSELDRWDSVSEPSAVDEAARRRITGRLR
LLLAKWNGTERGTERSAAHSELETATAEDIFDLISDEFGKSDEFGKS
selected fasta
>polyketide synthase [NigAVII]
ATGGCGGGCAATGAAGAGAAGCTGCTCGACTATCTGAAGCGGGTCACGGCGGATCTCCGT
CAGACGCAGCGGCGTCTCAAGGATGTCGAGTCCGCGGGGTATGAGCCGGTCGCGATCGTG
GGAATGTCCTGCCGCTTTCCCGGAGGCGTACGGTCCCCCGAAGAGCTGTGGGAACTGGTC
GCCGCGGAGCGGGACGCCATCTCGGAACTCCCCACGGACCGCAATTGGGATGTGGAGAAC
CTCTTCCATCCCGATCCGGAACACCCGGGGACGAGCTATACGTGCGAGGGCGGCTTCATC
GACGACCCCGCGGGATTCGACGCCGCCTTCTTCGGCATCAGCCCCCGCGAGGCCCTCGGG
ATGGCGCCCCAGCAGCGGCTGGCCCTCGAGGCGTCCTGGGAGGCCATCGAGCACGCCGGT
GTCGACCCGGAGTCGCTGCGTGGCAGCCGGACCGGCACCTTCATCGGCTGCGACCACCTG
GACTACTGCTCCGACGCCTCCCAGGTGCCCGAGGGCTCGGCCGGCTACTTCACCATCGGC
AACTCCGCCAGTGTGGTGTCCGGCCGCGTGGCGTACACCCTCGGTCTGGAGGGGGCCGCG
GTGACGGTGGACACCGCGTGCTCCTCCTCCCTGGTGGCCATGCATCTGGCCTGTCAGGCG
ATTCGGCAGGGCGAATGCGATATGGCGCTGGCCGGGGGCGTCGCCGTGATGTCCTCGACG
GCGCCGTTCATCGGCTTCAGCGAGTTGCGAGGGCTCGCACCGGACGGCAGGTCCAAGGCG
TTCTCGGCCAACAGTGACGGCATGACCCTGGCCGAGGGCGTGGGCGTCCTGCTGCTGGAA
CGGCTCGCGGACGCGCGCCGCAACGGCCACCAGGTGCTGGCCGTGGTCCGGGGCACGGCG
GTCAACCAGGACGGCGCAAGCAACGGCCTCACCGCGCCGAACGGGCCCTCGCAACAGCGA
GTGATCCGGCAGGCGCTCGCCAACGCCCGGCTGTCGCCGTCGGACGTGGACGCCGTCGAG
GCACACGGCACCGGAACCACGCTCGGCGACCCGATCGAGGCCCAGGCGCTGCTGGCCACG
TACGGGCAGGAGCGGCCCGAGGGACGTCCGCTGTGGCTGGGGTCCATCAAGTCCAACATC
GGACATGCGCAGATGGCCGCGGGCGCGGCCGGGGTCATCAAGATGGTGATGGCGATGCGG
CATGAAGTGCTGCCCGCATCGCTGCATATCGATGAGCCGACGCCCCATGTGGACTGGAGC
GCGGGCGATATCCATCTGCTCACCGAGGCGCGGGAGTGGCCACGCGGCGAGCATCCACGC
CGGGCGGGGATCTCTTCGTTCGGCATCAGCGGAACCAACGCACATGTCATCGTCGAGCAG
GCCCCCGAAGAACCGCCGGCGGCGGTCGGCGCTGGCGCGGGCGAACCGGTAGAGCCGGTG
GAGCCAGTGGGTGGGCCGGTGCCGTGGGTGGTGTCCGCGCGCGGGGCAGAGGCGTTACGG
GGCCAGGCGCGGGCACTGGCGGCACGGGTGAACGCCGACCCCGGGGTGAGCGCCGATGAA
GTGGGCTGGTCCCTGCTGCGGTCCAGGACCCTCTTCGACCACCGAGCCGTGGTCATCGGC
CAGAACCGCGAGGAGCTGGTCTCAGGGCTGGAGGCGTTGGCCGCCGGAGAACCACATCCG
GGTGTGGTGGAGGCTGGAAAGGCCGCCGAGGTTGCCGGACAGACCGTGTTCCTCTTCAGC
GGACAGGGCAGTCAGCGCCCCGGCATGGGCGCCGAACTCTACAACCGCTTCCCCATCTTC
GCCGAAGCCTTCGACGAAGTCTGCGCCCTCCTCGACCCACATCTAGAGCACCCGCTGCGG
GAGTTGGTCTTCAGCCGCGAACCCGAACAGGCCGCGTTGCTGGACCACACCACCTACGCC
CAGACCGGGCTGTTCGCCCTGCACATCGCCCTGGCACGACTGCTCGACTCACTCGGCGTA
CGACCCGACACCGTCATCGGACACTCCATCGGCGAGATCGCCGCCGCCCACATCGCCGGA
ATCTTCGACCTCCCCGACGCCTGCCACCTCGTCGCCACCCGCGCCACCCTCATGGGCGGA
CTCCGCGAAGGCGGGGGGATGGCCACCATCGCCGCCACCCCCGACGAACTCGCCGAGGAT
CTGGCCCGGTACGACGGGCAGGTGGGCATCGCCGCCCTCAACACTCCTGGCAACACCGTC
ATCTCCGGCCCGACCGATCTGGTCACCGATATCAGCGTCACCTGGGCGGCCAAAGGCCGT
AAGACCAGAACTCTGACTGTCAGCCACGCCTTCCACTCCTCCTTGATGGACCCCATCCTC
GAACCCTTCAAAGAAGCCATCAGCGGACTGACCTACCACCCACCCACCATCCCCCTCATC
AGCAACCTCACCGGACAACCAGCAGATGAACACATCACCACCCCCGACTACTGGGCCCAG
CACATCCGCCAACCCGTCCACTTCCACCCCGCCATCACCCATATCGCGCCCGAAACCGGC
ATCTTCCTCGAACTCGGCCCCGACCCCACCCTCACCACCGCAACCCACCACACCCTCCAC
CACCACACCAGCACCGAGCAGAACCCCACCAACCAGCCCACACCCCTGATCACACCCGCC
CTCACCCGTAAACAGCCCGAGTGGCAGGCCCTCACCCACGCCCTCGCCCGGCTCCACACC
GCCGGTGTCGAAATCGACTGGACCAGCTGGTTCCCCGCCGACCCGGCTCCCCGGGTGGTC
GGGTTGCCGACGTATGCCTTCCAGCACCAGCGCTTCTGGCTGGCCCCGCCAGCCGCCCGT
ACGAGCTTCGAGGGGACTGCCGGGGACCCTGCCGAGGCGCGGCTCTGGCATGCCATCGAG
GAACTCGATGTCGATGCCCTGAGCAGCACCCTCCGGCTGGAGAAGGACAGCCCCGGCATC
GACGCCCTGCTGCCCGCGCTCCCCGTACTGTCCACCTGGCGGCGTCAGCACCGCGAGCGT
TCGACCATCGACTCCTGGCGCTACCGGGCCACTTGGCAGCAGCTCCCCGACCCGCCCACA
CCGACCCTCACGGGCACCTGGCTGGTGGTCGTCCCCGCCGGGCAGGAGGAACACGCGACG
GTCCAAGTCACCGTCCAGGCGCTGCGGGCGCATGGCGCCACGGCACTCCGGCATGGGGTC
AACGCTCATGACATCGATCGCGCCGCGCTCCACGAACGCCTCGCCCGGCTCACCGAGGAG
TTCCAGCCCGCCGGAGTCATCAGCCTGCTCGCCCTCGACACGGAACCGCTCATCGGCCAC
TCCGCGGTGCCCGCCGGGCTCGGCGCCACCACCGCACTCCTTCAGGCTCTCGATGACGCC
GGAATCGGCACGCCCCTGTGGTGCCTCACCCAGGGCGCCGTCGCCACCGGCCGCGGCGAC
CTTCTCCCCCACCCCGGGCAATCGCAGATCTGGGGGTTCGGCCGGGTGGCCGCGCTGGAG
TATCCGCAGCGCTGGGGCGGCCTCATCGATCTGCCCACCACCATGACCCACCACACCGCG
GGTCGGCTGGCGGCGCTTCTCGTACCCGGGCAGCCCGAGGACCAGGTCGCCATCCGCACC
ACCGGGACGTACGCACGCCGCCTCGCCCGTGTGCCCGCCGCCGACACCGCCCCCGCCTCT
TGGGAGCCGTCCGGCACCACGCTCATCACCGGCGGCACCGGGGGTCTCGGCGCCCAGATC
GCCCGCTGGCTGGCCCACCGGGGCGCACCCCGTCTCCACCTCATCAGCCGTTCCGGACCC
GATGCGCCGGGCGCGTCCGAGCTCGGTGAGGAACTCACCGCTCTGGGGACGGACACCACC
ATCACCGCCTGCGATGCCTCCGACCGCGCCGCACTCCAGCGGCTCATCGACACCGTCCCC
GCCGAACACCCCCTCACCGCCGTCTTCCACACCGCCGGAACGATGGAACTCGGTCAGATC
GGCGAGCTGGAACCCGGGCGGTTGCAGTCCGTTCTGCGGTCGAAGGCCCTGGCCGCCGCT
CATCTGCACGACCTCACCCAGGACCTCGATCTCGCGGCCTTCGTGCTCTTCTCGTCCAAC
GCCGCGACCTGGGGCAGCGGGCAACAGGCCGCCTACGCCGCCGCGAACACCTACCTGGAC
GCGCTCGCCGAACACCGCCGGGCCCGGGGCCTGCCCGCCACCAGCCTCGCCTGGGGCCCC
TGGGGCGAGGCAGGCATGGCGGCCGACCAGCACACGCTCTCCCATCTCAAGCGGCGCGGT
CTCTCGCCCCTCCCCACCGACCTCGCCATCGCGTCGCTGCACCAGGCCCTGACACACGAC
GACACCGCCGTCACGATCGCGGATGTCGACTGGGAGACGTTCGGCCGTACGTTCACCGCG
CAGCGCCCGAGTCCGTTCCTCACCCGTCTGCTGCCGACAAGCGCGGAGCCCACCACGCCC
GCGGCCACCGCCGACGACAATCCGCTGCGGCAGCAGCTCGGTGCGGCGCCCACCGCTCAG
CGGCACCAGATCCTGGTGCGCCATATCCAGACCCTGGCCGCGACGATCCTCGGCCACCCC
GGGGCTGGACGCGATTCCCCAGGGCAGCCTTCCAGGAGACTGGGCTTCGACTCCCTCACC
GCCGTTGAGCTGCGCAATCAGCTCGCCGCCAGCACCGGGCTCTCGCTCGCCCCGGCGCTG
GTCTTCGACCATCCGACGCCGAACGCCCTCGCCACGTATCTGGGCGCCGAACTGACGGGG
CAGAGGGCCACCGTCGCCACCCATACGTCGTCCGTGGCCACCGATGACGAGCCGATCGCG
ATCGTCGGCATGGCCTGCCGCTACCCGGGCGGTGTGCGCTCACCGGAGGAGCTGTGGAAG
CTGGTCGCCGCAGGTCGGGACGCCATCGGGGAGATGCCCACCGACCGTGACTGGGATCTG
GACACGCTCTTCGATCCGGACCCGGAGCGCCTGGGCACCACCTATGCGCGTGAGGGCGGC
TTCCTCCACGATGCCGCCGGATTCGACGCGGCGTTCTTCGGCATCAGCCCACGCGAAGCG
CTCGCCATGGACCCTCAGCAGCGCCTGCTCCTGGAAACCGCCTGGGAGACCTTCGAGAGC
GCGGGCCTGGACCGGGACACACTCGCCGGGAGCAACACCGGCGTCTTCGCGGGCGGCACC
TATCAGGGCTACGGCGCCTCCGGAAGCTCCTCGGCGCGGGAGGTCGAGGGATACCTGCTC
GCGGGCGGTACGCCGAGTGTCATGTCGGGCCGGGTGGCGTATGCGTTCGGCCTCGAAGGC
CCGGCGGTCACGGTGGACACTGCGTGCTCGTCGTCCCTGGTGGCGATGCATCTGGCGGCC
CAGGCCCTGCGCCAGGGCGAATGCACGATGGCGCTGGCGGGTGGCGTCACCGTGATGGCC
ACGCCGACCACCTTCGTGGAGTTCTCCCGCCAGCGCGGACTGGCGGCCGACGGTCGCTGC
AAGCCGTTCGCGCTGGCCGCCGACGGCACCGGCTGGGGCGAGGGCGCCGGGCTCCTGCTG
CTGGAACGGCTGTCGGACGCACGCCGCAACGGCCACCGTGTGCTGGCGGTGATCCGGGGC
TCCGCCGTCAACCAGGACGGCACCAGCAACGGCCTCACCGCGCCGAACGGGCCCTCACAG
CAGCGAGTGATCGGCCAGGCGCTCACCAACGCCCGGGTGTCGCCCACAGAGGTCGATGCG
GTGGAGGGACACGGCACCGGGACCACGCTCGGGGACCCGATCGAGGCACAGGCGCTGCTC
GCCACGTACGGGCGGGAACGGCCCGAGGGACGTCCGCTCTGGCTCGGCTCCATCAAGTCC
AACATCGGCCACACCCAGGCCGCCTCCGGAGTGGCCGGGGTCATCAAGATGGTGATGGCG
ATGCGGCATGAAGTGCTGCCCGCATCGCTGCATATCGATGAGCCGACGCCCCATGTGGAC
TGGAGCGCGGGCGATGTCCAACTGCTGGCCGAGGCGCGGGAGTGGCCGCGCGGTGAGCAT
CCACGCCGGGCGGGGATCTCTTCGTTCGGCATCAGCGGAACCAACGCACATGTCATCGTC
GAGCAGGCCCCCGAAGAACCGCCGGCGGCGGTCGGCGCTGACGCGGGCGAACCGGTAGAG
CCGGTGGAGCGGGCGGAGTCGGTAGAGCCAGTGGGTGGGCCGGTGCCGTGGGTGGTGTCG
GCACGCGGGGCAGAGGCGTTACGGGGCCAGGTGCGGGCACTGGCGGCACGGGTGTACGCC
GACCCCGGGGTGAGCGCCGATGAAGTGGGCTGGTCCCTGCTGCGGTCCAGGACCCTCTTC
GACCACCGAGCCGTGATCATCGGCCAGAACCGCGAAGAACTGACGGCGGGACTGGAGGCA
CTGGCCGCCGGAGAACCACATCCGGGCCTGGTGGAGCCCGGAGAGGCCACCGACACCACG
GGCAAGACGGTCTTCCTCTTCAGCGGACAGGGCAGCCAGCGCCCCGGCATGGGCGCCGAA
CTCTACAACCGCTTCCCCATCTTCGCCGAAGCCTTCGACGAAGTCTGCGCCCTCCTCGAC
CCACACCTGGAACACCCACTACGACAGGTGGTCTTCGATACCTCCGCGGAGCATGCCGGG
CTGTTGGACCACACCACCTACGCCCAGGCCGGGCTGTTCGCCCTGCACATCGCCCTGGCC
CGACTGCTCGACTCCGTGGGAGTACGACCCGACACCGTCATCGGACACTCCATCGGCGAA
ATCGCCGCCGCCCACATCGCCGGAATCTTCGACCTCCCCGACGCCTGCCACCTCGTCGCC
ACCCGCGCCACCCTCATGGGCCAACTACCCCAAGGCGGCAGCATGGCCACCATCGCCGCC
ACCCCCGACGAACTCGCCAACGACCTGGCCCAACACGCCGGCCAGGTAAGCATCGCCGTC
CTCAACACCCCCACCAACACCGTCATCTCCGGACCCACCGAACTCATCACCAACATCAGC
ACCACCTGGGCAGCCAAAGGCCGTAAAACCCGCACCCTCACCGTCAGCCACGCCTTCCAC
TCCCCACTCATGGACCCCATCCTCGAACCCTTCAAAGAAGCCATCAGCGGACTGACCTAC
CACCCACCCACCATCCCCCTCATCAGCAACCTCACCGGACAACCAGCAGACGAACACATC
ACCACCCCCGACTACTGGGCCCAACACATCCGCCAACCCGTCCACTTCCACCCCGCCATC
ACCCACACCGCACCCCACACCAGCACCTTCCTCGAACTCGGCCCCGACCCCACCCTCACC
ACCGCAACCCACCACACCCTCCACCACCACACCAGCACCGAGCAGAACCCCACCAACCAG
CTAACGCCACTGATCACATCCACCCTCACCCGTAAACAGCCCGAGCGGCAAGCCCTCACC
CACGCCCTCGCCCGGCTCCACACCGCCGGTGTCGAAATCGACTGGACCAGCTGGTATCCC
GCCACCCCCACCCCCCGCACCATCGACCTCCCCACCTACGCCTTTCAACACCAGCACTAC
TGGCTGTCGTCGGCCCCCTCCTCGAGTCCGACGCCCACCGAGGCAGCTCTGGTCGACAGG
AAGTTCTGGGAGGCGGTGGAGCGCGAGGATCTGGAAGCCCTGGCGGCGACCATCGACTCA
CCGGCTGACCAGCAGCCCATGCTGAGTGCCGTGCTCCCGACGCTGTCCGCTTGGCGGCGG
CATCACCGGGAGCAGTCGGTCATCAATTCCTGGCGGTATCAGATCGCCTGGAAGCGCCTT
TCCGCTCCCTCCACACCTCCGGACCTCTCCGGCACCTGGCTGCTGATCATCCCCGCCGGT
CAGTCCGACCACCCTGCTGTGGAAACCGTCGCGCATGCCCTGACCACCCACGGTGCCACC
CCGATCCGCCATATGCTCGACACCCACACCGTCGATCGCGACGCCCTGGCGGACCACCTC
ACGCGTCTGGCCATGCAGGGCGAACCCGCCGGAGTGCTGAGCCTGCTCGCACTCGACGAG
GAGCCGCACCCCGAATATGCCGCCGTGCCCTCCGGGCTGGCCGCGACCACCGTGCTCCTC
CAGGCCCTCGGGGACGCCGAGATCCCGGCACCCCTGTGGTGCCTCACCCAGGGCGCCGTC
GCCACCGGTCCCGGCGATCCGCTCCCCAGTCCGCGGCAGGCGCAGACATGGGGACTTGGC
CGCGCCGCGGCCCTCGAACACCCTCGCCGCTGGGGTGGCCTGATCGACCTCCCGGCCGTC
ATCGACCACCACACCGCCGACCGTCTGGCCGCCCTGCTCACCCCCGGTCGGCCGGAGGAC
CAGACCGCCATCCGCGCCACCGGCAGCTACGCCCGGCGCCTCCGTAAGGCCACCGCCCCC
ACCGCCGCCCCCAGGACGTGGCAGCCCACGGGCACCACGCTCATCACCGGCGGCACCGGT
GGCCTCGGCGCCCATGTCGCCCGCTGGCTCGCCCGCCTTGGCGCACCCCATCTCCACCTC
ATCAGCCGTTCCGGTCCGGACGCACCCGGGGCCAGCCAACTCACCCAAGAACTCATCGAC
TTGGGCACGGCTGTCACCATCACCGCCTGCGACGCCTCCGACCGTGCCGCACTCCAGCGC
CTTCTCGACACCATCCCCGCCGAACACCCCCTCACCACCGTCATCCACGCCGCCGGAACG
TCGGACACCGAGCTCCTCGCCGATCTGGGTCCGGAGCGGCTGGAGCATGTGCTCGGGCCC
AAGGCCCTGGCCGCCGCCCATCTGCATGAACTGACCCAGGAGCTCGACCTCAGCGCCTTC
GTGCTCTTCTCGTCCGGCGCGGCGGCGTGGGGCGGCAGTCGCCAAGGGGCCTACGCCGCC
GCCAACACCTACCTGGACGCGCTCGCCGAACACCGCCGCGCCCGGGGCCTGCCCGCCACC
AGCCTCGCCTGGGGCCCCTGGGGCGACGCGGGCATGGCCGCCGACGAAACCGCGCTCGCG
TTCTACGGCCGACGTGGACTGTCTCCGCTGAGCCCCGAACTGGCCGTCGCATCGCTCCAG
CACGCCCTGGACCACCGTGACACCACGATCACCGTCGCCGACATCGACTGGGAGAAGTTC
CCGGCGGCGTTCACCGCCCAGCGCCCCAGCCCGCTGCTCGACGACCTGATCACGGCCATC
GAGAGCCCGGCCGAACCAATCACGGGCGCATCCACCGGCACCTCGCTCCAGCAGCGGCTC
TCCGCAGGCACCCCCGAGCAACAGCACCAGCTCCTGCTCGAACGCATCCAGTCCCTCGCG
GCCTCGATCCTGGGGCATTCCGGGCCGGACGCCATTCCGCCCGCCCAGCCGTTCCAGGAG
CTCGGGTTCGACTCCCTGACCGCCGTGGAGCTGCGCAACCAGCTCGCCACCGCCACCGGA
ATCGACCTCGCGCCCGCGCTCGTCTTCGACCATCCCACGCCCAATGCCCTGGCCACCTAC
CTCCGCGCCGAACTCACGGGCCAGCAGACGGCCGTCGCCGCCCACAGCCCCACCACGGCC
GCCCAGGACGAGCCGATCGCGATCGTCGGCATGGCCTGCCGCTACCCCGGAGACGCACAC
TCCCCGCAGGATCTCTGGGAGCTGGTCATCGCCCACCGCGATGCCATCGCGCAGATGCCC
ACCGACCGCAACTGGGATCTGGACGCGCTCTACGACCCCGACCCCGACCGCGCGGGGACG
AGCTACGTCCGCGAGGGCGGCTTCCTCCGCCACGCGGCCGAGTTCGACCCCGCGTTCTTC
GGCATCAGCCCGCGCGAGGCGATCGCCATGGACCCGCAGCAGCGGCTGCTCCTGGAGACC
GCCTGGGAGACCTTCGAGAGCGCGGGCCTGGACCGGGACACGCTCGCGGGCAGCAACACC
GGAGTGTTCGCGGGGGTGACCTCGCAGGACTATCTGTCCCTCACCGGCGATACGGCGAGC
GATGTCGAAGGCTATGTCGCCACGGGCAATATCGGCAGTGTGGTGTCCGGCCGGGTGGCC
TACTCGTTCGGCCTCGAAGGCCCGGCGGTCACGGTGGACACCGCGTGCTCATCCTCCCTG
GTGGCGATGCATCTGGCGGCCCAGGCCCTACGCCAAGGCGAATGCACGATGGCGTTGGCG
GGTGGCGTCACCGTGATGGCCACGCCGGGTGCGTTCATCGAGTTCTCCCGCCAGCGCGGT
CTTGCACCCGACGCGCGGTGCAAACCGTTCGCGGCAGCGGCGGACGGCATGGTGTGGGGC
GAGGGCGTCGGCCTCGTACTGCTGGAACGGCTGTCGGACGCGCGCCGCAACGGCCACCGT
GTGCTGGCCGTCGTCCGGGGCTCCGCCGTCAACCAGGACGGCACCAGCAACGGCCTCACC
GCGCCGAACGGACCCTCACAGCAACGGGTGATCCGGCAGGCGCTCGCCAACGCGCGGCTG
TCGCCGTCGGACGTGGACGCCGTCGAGGCACACGGCACCGGGACCACTCTGGGCGACCCG
ATCGAGGCACAGGCGCTGCTGGCCACCTACGGACAGGAACGGCCCGAGGGACATCCGCTG
TGGCTCGGCTCCATCAAGTCCAACATCGGCCACACCCAGGCCGCCGCCGGAGTGGCCGGA
GTCATCAAGATGGTGATGGCCATGCGCCACGAGCTGCTGCCCGCATCACTCCACATCGAC
GAACCGTCCCCGAATGTCGACTGGAACGCGGGCGACCTGCGCCTGCTCGCCGAAACCGTC
CCCTGGCCCCAGGGCGACCGGGCCCGCCGGGCGGGGGTCTCCTCCTTCGGCATCTCGGGT
ACGAACGCCCATCTCATCCTTGAGCAAGCCCCCGAACCGGCCGAGCCCGCCCCCGTATCG
AACATCGCGGGGGTCGTGCCATGGGTGGTCTCCGCACAGAGCGACGCGGCGCTACGGGGC
CAGGCGCGAGCCTTGGCCGGGCACATCATCGGCGACCCCGAGGTGAGCGCCGGAGAGGTG
GGCTGGTCCCTGCTGCGGTCCAGGACCCTCTTCGACCACCGAGCCGTGGTCATCGGCCAG
AACCGCGAAGAACTGACGGCGGGACTGGAGGCACTGGCCGCCGGAGAACCACATCCGGGC
CTGGTGGAGCCCGGAGAGGCCACCGACACCACGGGCAAGACGGTCTTCCTCTTCAGCGGA
CAGGGCAGCCAGCGCCCCGGCATGGGCACCGAACTCTACAACCGCTTCCCCATCTTCGCC
GAAGCCTTCGACGAAGTCTGCGCCCTCCTCGACCCCCACCTGGAACACCCACTACGGCAG
GTGGTCTTCAGCCGCGAACCCGAACAGGCCACGTTGCTGGACCACACCACCTACGCCCAG
GCCGGACTGTTCGCCCTCCACATCGCCCTGGCACGACTACTCGACTCCGTGGGAGTACGA
CCCGACACCGTCATCGGACACTCCATCGGCGAAATCGCCGCCGCCCACATCGCCGGAATC
TTCGACCTCCCCGACGCCTGCCACCTCGTCGCCACCCGCGCCACCCTCATGGGCCAACTA
CCCCAAGGCGGCGGCATGGCCACCATAGGCGCCACCCCAGAGGAACTCGCCGAGGATCTG
GCCCGGTACGACGGGCAGGTGAGCATCGCCGCCCTCAACACCCCCACCAACACCGTCATC
TCCGGACCGACCAACCTGGTCACCGATGTCAGCGCCACCTGGGCGGCCAAAGGCCGTAAA
ACCCGCACCCTCACCGTCAGCCACGCCTTCCACTCCCCACTCATGGACCCCATCCTCGAA
CCCTTCAAAGAAGCCATCAGCGGACTGACCTACCACCCACCCACCATCCCCCTCATCAGC
AACCTCACCGGACAACCAGCGGATGAGCACATCACCACCCCCGACTACTGGGCCCAACAC
ATCCGCCAACCCGTCCACTTCCACCCCGCCATCACCCACACCGCACCCCACACCAGCACC
TTCCTCGAACTCGGCCCCGACCCCACCCTCGCCACCGCAACCCACCACACCCTCCACCAC
CACACCAGCACCGAACAGAACCCCACCAACCAGCCCACACCCCTGATCACATCCACCCTC
ACCCACAAACGACCCGACACCCACGCCCTAACCCACACCCTCGCCCAACTCCACACCAGC
GGCACCACCATCGACTGGACCAGCTGGTACCCCGCCATCCCCACCCCCCGCACCATCGAC
CTCCCCACCTACGCCTTCCAACACCAGCACTACTGGCTCGCCCCGCCCACGCCACGTGCC
GACAGTCGTCTCAACGGCCACAACCCGGCCGAGGCCAGGCTCTGGGACGCCATCGAGGAG
CTGGACGTCGACGCCCTCGCAAGCACACTCGACCTGGAGAAGGACAGCCCCGGCGTTGGC
GCCCTGCTGCCCGCGCTCCCCGTACTGTCGACCTGGCGCCGCCGGCACCGCGAACGGTCC
ACCATCGACTCCTGGCGTTACCGCGTCGCATGGAAGCAGGTGCGGGACCCCGCCACCGCG
CCGACCCTCAGCGGGACCTGGCTGCTGCTCGTGCCCACCGGGCTGGAGGAACATGCGGCC
GTCCACGCCACCGTCGAGGCGCTCGACGCCCATGGCGCGGCCCACGAGGTTCTGTCCATC
GATGGCGCGGACGCCCGGCGCGACGCCATCGCCCCGCTGCTTTCGCAGCTGCCCGATGGC
AGCACCCCCGAGGGCATTCTGAGTCTGCTCGCGCTCGACCGGACGCCCCACCCCGACCAC
CCGGCCGTCCCCACAGGGCTGGCCGCCACCGCCGCCCTCGTCCAGGCCCTCGGCGAGGCG
CCGCTCATCGCGCCCCTGTGGTGTGTCACCCAAGGCGCGGTGGCCACCAACGCCGCCGAT
CCGCTGCCCCACCCGCACCAGGCCCAGATCTGGGGCATGGGCCGGGTCGCCGCGCTGGAA
CACCCCCGGCTCTGGGGCGGCCTCATCGACCTCCCGGCCGTCGCCGACGCCCGCACCCCA
GCCCGTATCGCCGCCATGCTGGTGCCCGGTCAGCCGGAGGACCAGGTGGCGATCCGCTCC
ACGGTCCTGGCCCGGCGCCTGGAGGGGGCCGTCTGCCCGGACACCGCGCCCACCGCGTGG
CGCCCCGCCGGTACGACCCTGATCACCGGTGGCACGGGGGGTCTCGGCGCCCATGTCGCC
CGCTGGCTGGCCCGCCAGGGCGCACCCCATCTCCACCTTGTCAGCCGCTCAGGACCCGAC
GCGCCCGGTGCCGCCCAACTCGCCCAAGACCTGGACGACTTGGGCGCAACCATCACCATC
ACCGCCTGCGATGTCTCCGACCGAGCCGCGCTCCAGCGCCTTCTCGACACCATCCCCGCC
GAACACCCCCTCACCGCCGTCGTCCACGCCGCCGGTCTCCCGGAGAACACCCCGCTCGCC
GAGCTGGATCTCCCGGGGATCGACGCTGTGCTGCGGCCCAAAGCACTCGCGGCCGCCCTG
CTCCATGAACTCACCGAGGAGCTGGACCTCAGCGCCTTCGTGCTCTTCTCGTCCGGCGCC
GCCGCGTGGGGCGGCGGCCGACAGCCGTCCTACGCCGCCGCCAACGCCTATCTCGACGCC
CTCGCCGAACACCGCCGGGCCCGGGGCCTGGCCGCCACCAGCCTCGCCTGGGCGCCGTGG
AGCGATGCGGGCATGGCGTCCGACGAGGCCGCCGTCGACTACTACCGCCGGCGCGGGATG
CGTCCCCTGGACACCGATCTCGCCATCGCCTCGCTCCAGCACGCCCTGGACCACGGCGAC
ACCACGATCACCATCGCGGACATCGACTGGGAGAGGTTCCCGGCCGGTTTCACCGCACAG
CGGCCCAGCCCGCTGCTGTCCGACCTGGCCGCCGCCGCGTCGCCCGGCCCCGATGCCGCC
CCGGACGCCACCGCGGCCATGAGCGGTTCGCTTCAACGGCAGCTGGCCACCGGCACGCTC
GCCCAGCGGCACCAACTTCTTCTGCATCACATCCAGACGCACGCCGCCGCGATCCTCGGC
CACCCCACCATCGATGCGATCCCACCCGCCCAGCCATTCCAGGAGCTGGGGTTCGACTCC
CTCACGGCCGTCGAATTCGGGCACCGCCTCTCCGCCGCCACCGGCGTCGACCTCCCGCCC
ACCCTTGTCTTCGACCACCCCACGCCCAAGGAGCTGGCCGACTATCTGCGCGAGCGGCTC
GTCGAGGGGGAGCCGACCTCCGAGGGACATCTGCTGTCGGAGCTCGACCGGTGGGACTCG
GTCTCGGAGCCCTCGGCGGTGGACGAGGCGGCCCGTCGCCGGATCACCGGACGGCTGCGG
CTGCTGCTGGCCAAGTGGAACGGCACGGAACGGGGCACGGAGCGTTCCGCGGCCCACAGC
GAGCTCGAGACGGCGACGGCAGAGGACATTTTCGACCTCATCTCGGACGAGTTCGGAAAG
TCCGACGAGTTCGGAAAGTCGTGA
[10] KS35..411
[10] AT576..904
[10] malonyl-CoA769..773
[10] KR1225..1404
[10] ACP1505..1575
[11] KS1596..1973
[11] AT2144..2472
[11] malonyl-CoA2337..2341
[11] KR2791..2970
[11] ACP3072..3142
[12] KS3163..3540
[12] AT3695..4022
[12] malonyl-CoA3888..3892
[12] KR4344..4523
[12] ACP4627..4697
[10] KS103..1233
[10] AT1726..2712
[10] malonyl-CoA2305..2319
[10] KR3673..4212
[10] ACP4513..4725
[11] KS4786..5919
[11] AT6430..7416
[11] malonyl-CoA7009..7023
[11] KR8371..8910
[11] ACP9214..9426
[12] KS9487..10620
[12] AT11083..12066
[12] malonyl-CoA11662..11676
[12] KR13030..13569
[12] ACP13879..14091

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [569-701]  G3DSA:3.40.366.10 [769-894]  G3DSA:3.40.366.10 [2137-2269]  G3DSA:3.40.366.10 [2337-2461]  G3DSA:3.40.366.10 [3688-3820]  G3DSA:3.40.366.10 [3888-4010]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR006162 Phosphopantetheine attachment site (PTM)
 [1533-1548]  PS00012 [3100-3115]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1505-1575]  PS50075 [3072-3142]  PS50075 [4627-4697]  PS50075
PS50075   ACP_DOMAIN
 [1505-1579]  2.80000000000001e-63 G3DSA:1.10.1200.10 [3070-3146]  2.80000000000001e-63 G3DSA:1.10.1200.10 [4626-4701]  2.80000000000001e-63 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1509-1574]  8.40000000000001e-08 PF00550 [3074-3141]  2.7e-13 PF00550 [4631-4696]  2.9e-14 PF00550
PF00550   PP-binding
 [1498-1613]  4.70000326671387e-24 SSF47336 [3065-3180]  1.29999924468179e-29 SSF47336 [4618-4704]  3.00000067992871e-21 SSF47336
SSF47336   ACP_like
IPR013968 Polyketide synthase, KR (Domain)
 [1225-1403]  1.9e-58 PF08659 [2791-2969]  3.7e-62 PF08659 [4344-4522]  5.59999999999999e-61 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [35-285]  2.70000000000002e-94 PF00109 [1596-1847]  5.6e-97 PF00109 [3163-3414]  1.69999999999998e-99 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [293-411]  2.8e-48 PF02801 [1855-1973]  3.2e-46 PF02801 [3422-3540]  8.70000000000003e-49 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [576-904]  1.99999999999999e-63 PF00698 [2144-2472]  1.5e-64 PF00698 [3695-4022]  3.7e-64 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [5-35]  9.20000434662057e-06 SSF101173
SSF101173   Polyketide_synth_docking
 [3-28]  3.5e-12 PF08990
PF08990   Docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [574-877]  5.10003242202156e-68 SSF52151 [2142-2445]  1.69998802370953e-69 SSF52151 [3693-3996]  3.79997359309398e-68 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [703-768]  1.89999859865864e-15 SSF55048 [2271-2336]  1.20000117458134e-14 SSF55048 [3822-3887]  2.00000075217457e-16 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [37-297]  G3DSA:3.40.47.10 [298-465]  G3DSA:3.40.47.10 [1596-1858]  G3DSA:3.40.47.10 [1859-2027]  G3DSA:3.40.47.10 [3163-3425]  G3DSA:3.40.47.10 [3426-3593]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [27-463]  2.50000909916183e-104 SSF53901 [1589-2025]  1.69998802370953e-101 SSF53901 [3156-3529]  2.80000504261099e-104 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1226-1410]  1.29999999999998e-113 G3DSA:3.40.50.720 [2792-2976]  1.29999999999998e-113 G3DSA:3.40.50.720 [4345-4560]  2.70000000000002e-111 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [1760-1776]  PS00606 [3327-3343]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [578-885]  5.20000089003336e-122 SM00827 [2146-2453]  4.89996723796399e-121 SM00827 [3697-4004]  3.60002015031011e-121 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1506-1578]  3.0999994589937e-26 SM00823 [3073-3145]  7.0999832511256e-33 SM00823 [4628-4700]  3.49999466863949e-35 SM00823
SM00823   PKS_PP
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [37-463]  SM00825 [1599-2025]  SM00825 [3166-3592]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1225-1404]  9.90001804798395e-54 SM00822 [2791-2970]  3.10001307370206e-53 SM00822 [4344-4523]  1.20000117458134e-51 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit