close all open/close all
Niger_00170 Niger_00170   last last

CDS information : Niger_00180


close this sectionLocation

Organism
StrainDSM 4137
Entry nameNigericin
Contig
Start / Stop / Direction93,948 / 93,400 / - [in whole cluster]
93,948 / 93,400 / - [in contig]
Locationcomplement(93400..93948) [in whole cluster]
complement(93400..93948) [in contig]
TypeCDS
Length549 bp (182 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)unknown
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF9
Reference
ACC
PmId
[17584617] Insights into polyether biosynthesis from analysis of the nigericin biosynthetic gene cluster in Streptomyces sp. DSM4137. (Chem Biol. , 2007)

close this sectionSequence

selected fasta
>hypothetical protein [unknown]
MSLVALAVSPVNAEPDTGAKPPHGKNPLPAPPQIRDLDFLLGSYTCDYTPPPGGKPAVLK
LTTKRAMGGHYLYTDATLEPGSVVGRTSLGWNPVDGKFINQYHDNWGSSGNYTSSGWKDG
HLIFKGPLTQVITPNGSGQTTGVKLDLVDDYQVLGPGHFKDTTSFTFPDGSTLQGSYDCR
RQ
selected fasta
>hypothetical protein [unknown]
GTGAGCCTGGTCGCGCTCGCCGTCTCCCCGGTGAACGCCGAACCCGATACCGGAGCGAAA
CCGCCGCACGGCAAAAATCCCCTTCCCGCTCCCCCGCAGATCCGCGATCTCGACTTTCTG
CTCGGCTCCTACACCTGCGACTACACCCCACCCCCGGGCGGAAAGCCGGCGGTGCTGAAG
CTGACCACCAAGCGGGCGATGGGCGGGCACTACCTCTACACGGACGCCACGCTCGAGCCG
GGCAGCGTGGTCGGCCGTACGTCCTTGGGCTGGAATCCCGTCGACGGGAAATTCATCAAC
CAGTACCACGACAACTGGGGTTCATCCGGAAACTACACCTCGTCCGGCTGGAAGGACGGC
CACCTGATATTCAAGGGTCCCCTCACCCAGGTGATCACACCGAATGGTTCCGGGCAGACA
ACCGGCGTGAAGCTGGACCTCGTGGACGACTACCAGGTGCTCGGCCCAGGACATTTCAAG
GACACCACGAGCTTCACCTTCCCCGACGGAAGTACTTTGCAGGGCAGTTACGACTGCCGC
CGCCAATAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-13]  0.81 Signal
Eukaryota   
 [1-13]  0.749 Signal
Bacteria, Gram-negative   
TMHMM No significant hit
Niger_00170 Niger_00170   last last