close all open/close all
first first   Nogl_00020 Nogl_00020

CDS information : Nogl_00010


close this sectionLocation

Organism
StrainATCC 27451 (=NBRC 13445)
Entry nameNogalamycin
Contig
Start / Stop / Direction382 / 2 / - [in whole cluster]
382 / 2 / - [in contig]
Locationcomplement(2..382) [in whole cluster]
complement(2..382) [in contig]
TypeCDS
Length381 bp (126 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative ADA-like regulatory protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in nogalamycin biosynthesis.
Note (GenBank)
  • Orf10; similar to Streptomyces coelicolor A3 (2) putative ADA-like regulatory protein

close this sectionSequence

selected fasta
>[putative ADA-like regulatory protein]
MTFHPSAAACQQAGFRACKRCRPDTSPGSPEWNRRADLVARAMRLIADGVVDREGVPGLA
ARLGYSTRQVERQLLAELGAGPLALARAQRAQTARMLIETTALPMADIAFAAGFSSIRGF
NDTVREI
selected fasta
>[putative ADA-like regulatory protein]
ATGACGTTCCACCCGAGTGCCGCCGCCTGTCAGCAGGCCGGGTTCCGGGCCTGCAAGCGC
TGCCGCCCCGACACCAGCCCCGGCTCCCCGGAGTGGAACCGGCGCGCCGACCTGGTCGCC
CGCGCCATGCGGCTGATCGCCGACGGCGTCGTGGACCGCGAGGGCGTGCCCGGACTCGCC
GCCCGGCTCGGCTACAGCACCCGCCAGGTGGAACGGCAACTCCTCGCCGAACTGGGCGCC
GGACCCCTCGCGCTCGCCCGCGCCCAGCGCGCCCAGACCGCGCGGATGCTCATCGAGACC
ACCGCGCTGCCCATGGCCGACATCGCGTTCGCGGCCGGCTTCTCCTCCATACGCGGCTTC
AACGACACCGTCCGCGAGATC

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004026 Ada DNA repair, metal-binding (Domain)
 [2-38]  4.9e-11 G3DSA:3.40.10.10
G3DSA:3.40.10.10   Ada_DNA_repair_Zn-bd
 [1-41]  1.30000067202732e-08 SSF57884
SSF57884   Ada_DNA_repair_Zn-bd
 [2-24]  5.8e-07 PF02805
PF02805   Ada_Zn_binding
IPR009057 Homeodomain-like (Domain)
 [89-122]  2.5e-06 G3DSA:1.10.10.60
G3DSA:1.10.10.60   Homeodomain-rel
IPR018060 DNA binding HTH domain, AraC-type (Domain)
 [40-127]  PS01124
PS01124   HTH_ARAC_FAMILY_2
SignalP
 [1-9]  0.434 Signal
Bacteria, Gram-negative   
TMHMM No significant hit
first first   Nogl_00020 Nogl_00020