close all open/close all

CDS information : Nogl_00020


close this sectionLocation

Organism
StrainATCC 27451 (=NBRC 13445)
Entry nameNogalamycin
Contig
Start / Stop / Direction1,470 / 616 / - [in whole cluster]
1,470 / 616 / - [in contig]
Locationcomplement(616..1470) [in whole cluster]
complement(616..1470) [in contig]
TypeCDS
Length855 bp (284 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)unknown
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in nogalamycin biosynthesis.
Note (GenBank)
  • Orf9

close this sectionSequence

selected fasta
>[unknown]
MNPALLDDFSLEMTGKDVPRLEEARDGIPPGTRINITFLAGEDTATRLTAARAVKRLGFV
PVPHISARRLPSRPALEEFLAGLAAHGTAENVFVVGGDPARPEGPYADALAVLRTGLLRR
HGVRHVGIAGYPEGHPGITDRALWSALTDKAAAIDADRFGGDVITQFGFDADPVLAWLEA
LRARGVRLPVRVGVPGPAGVRRLLGYATRFGVGTSASVARKYGFSLTNLMGTTGPDRFLH
ALADRYDPGRHGVVKVHFYTFGGLRATAEWVDGFRRQHTPAPAP
selected fasta
>[unknown]
ATGAACCCCGCTCTGCTGGACGACTTCTCCCTGGAGATGACCGGCAAGGACGTGCCCCGG
CTGGAGGAGGCGCGCGACGGCATCCCGCCGGGCACCCGGATCAACATCACCTTCCTGGCC
GGCGAGGACACCGCCACCCGGCTCACGGCGGCCCGCGCGGTCAAGCGGCTCGGCTTCGTC
CCCGTACCGCACATCTCCGCCCGCCGGCTGCCCTCCCGGCCCGCCCTGGAGGAGTTCCTC
GCCGGGCTGGCGGCCCACGGCACCGCCGAGAACGTGTTCGTCGTCGGCGGCGACCCCGCC
CGGCCCGAGGGCCCCTACGCGGACGCCCTGGCCGTGCTGCGCACCGGGCTGCTGCGCCGC
CACGGCGTCCGGCACGTCGGCATCGCCGGCTATCCGGAAGGCCACCCCGGCATCACCGAC
CGGGCCCTGTGGTCGGCGCTCACGGACAAGGCGGCCGCCATCGACGCGGACCGGTTCGGC
GGGGACGTGATCACCCAGTTCGGCTTCGACGCGGACCCGGTCCTCGCCTGGCTGGAGGCC
CTGCGCGCCCGGGGCGTGCGCCTGCCCGTCCGGGTCGGCGTCCCCGGACCGGCCGGGGTG
CGCCGGCTGCTGGGCTACGCCACCCGGTTCGGCGTCGGCACCAGCGCCTCCGTCGCCCGC
AAGTACGGTTTCTCGCTGACCAACCTCATGGGCACCACCGGCCCGGACCGCTTCCTGCAC
GCGCTGGCCGACCGCTACGACCCCGGCCGGCACGGCGTGGTGAAGGTGCACTTCTACACC
TTCGGCGGACTGCGCGCCACCGCCGAGTGGGTCGACGGATTCCGGCGGCAGCACACTCCC
GCGCCCGCACCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003171 Methylenetetrahydrofolate reductase (Family)
 [34-194]  7.5e-07 PF02219
PF02219   MTHFR
SignalP
 [1-67]  0.035 Signal
Bacteria, Gram-positive   
TMHMM No significant hit