close all open/close all

CDS information : Nogl_00030


close this sectionLocation

Organism
StrainATCC 27451 (=NBRC 13445)
Entry nameNogalamycin
Contig
Start / Stop / Direction2,849 / 3,583 / + [in whole cluster]
2,849 / 3,583 / + [in contig]
Location2849..3583 [in whole cluster]
2849..3583 [in contig]
TypeCDS
Length735 bp (244 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative acetoacetate decarboxylase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in nogalamycin biosynthesis.
Note (GenBank)
  • Orf8

close this sectionSequence

selected fasta
>[putative acetoacetate decarboxylase]
MRAEDVVRAPSTPLDAPAFPAGPYRFTDREYLNITYRTDPEALRRVVPEPLRVAEPLVRF
EVMRMPDVTGLGDYTEAGQLAVVEYEGEPGEYGISIHVDNFPAIASGREIGAFPKKAGRP
RLYVDQDTLVGTLDHGTLPVARATMGYKHRPLNTEQAREELTRPTFMLKKLPHYDGSPRI
CELVRTQIADIVVKGAWSGPARLQLFAHALAPLADLPVLEVVSAAHVLTDLTLGRARVVH
DYLA
selected fasta
>[putative acetoacetate decarboxylase]
ATGCGAGCCGAGGACGTCGTCCGTGCACCGTCGACACCGCTGGATGCCCCGGCCTTCCCG
GCGGGCCCGTACCGGTTCACCGACCGCGAGTACCTGAACATCACCTACCGGACGGACCCC
GAGGCCCTGCGCCGGGTGGTGCCGGAGCCGCTGCGGGTGGCGGAGCCGCTGGTCCGCTTC
GAGGTCATGCGGATGCCGGACGTCACCGGTCTGGGCGACTACACCGAGGCCGGTCAGCTG
GCCGTCGTGGAGTACGAGGGCGAGCCGGGCGAGTACGGCATCTCGATCCACGTGGACAAT
TTCCCCGCCATCGCGAGCGGCCGGGAGATCGGCGCCTTCCCGAAGAAGGCCGGCCGCCCC
CGGCTCTACGTCGACCAGGACACCCTGGTCGGCACCCTCGACCACGGCACGCTGCCCGTG
GCCCGCGCCACGATGGGCTACAAGCACCGGCCGCTGAACACGGAGCAGGCCCGCGAGGAG
CTGACCCGGCCGACGTTCATGCTCAAGAAGCTGCCGCACTACGACGGTTCGCCGCGCATC
TGCGAACTCGTCCGGACGCAGATCGCCGACATCGTGGTCAAGGGCGCCTGGAGCGGTCCC
GCACGGCTCCAGCTCTTCGCCCACGCGCTGGCCCCGCTCGCGGACCTGCCGGTCCTGGAG
GTCGTCTCCGCCGCCCACGTCCTGACCGATCTGACCCTGGGCCGCGCCCGGGTCGTCCAC
GACTACCTCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR010451 Acetoacetate decarboxylase (Family)
 [15-243]  9.39999999999981e-73 PF06314
PF06314   ADC
IPR017956 AT hook, DNA-binding motif (Conserved_site)
 [114-126]  0.00819999956645524 SM00384
SM00384   AT_hook
IPR023375 Acetoacetate decarboxylase beta barrel domain (Domain)
 [13-244]  4.2e-100 G3DSA:2.40.400.10
G3DSA:2.40.400.10   G3DSA:2.40.400.10
SignalP No significant hit
TMHMM No significant hit