close all open/close all

CDS information : Nogl_00040


close this sectionLocation

Organism
StrainATCC 27451 (=NBRC 13445)
Entry nameNogalamycin
Contig
Start / Stop / Direction4,422 / 3,877 / - [in whole cluster]
4,422 / 3,877 / - [in contig]
Locationcomplement(3877..4422) [in whole cluster]
complement(3877..4422) [in contig]
TypeCDS
Length546 bp (181 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)unknown
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in nogalamycin biosynthesis.
Note (GenBank)
  • Orf7; similar to Streptomyces coelicolor A3 (2) hypothetical protein SC9B5.17

close this sectionSequence

selected fasta
>[unknown]
MTTITLVQGDITRQHADALVNAANSSLLGGGGVDGAIHRRGGPAILAECRALRASRYGEG
LPTGRAVATTAGDLDARWVIHTVGPVWSSTEDRSDLLASCYRESLRLAGELGARTVAFPA
LSTGVYRWPMGDAARIAVETVRTTPTAVEEVRFVLFDTHAYDTFARELGDAGHAGHAGHP
G
selected fasta
>[unknown]
ATGACCACCATCACCCTCGTCCAGGGCGACATCACCCGGCAGCACGCCGACGCCCTCGTC
AACGCGGCCAACTCCTCGCTCCTGGGCGGCGGGGGAGTGGACGGCGCGATCCACCGTCGC
GGCGGCCCGGCCATCCTGGCGGAGTGCCGCGCGCTGCGCGCCTCCCGGTACGGCGAGGGC
CTGCCCACCGGCCGGGCGGTCGCCACCACGGCGGGTGACCTGGACGCCCGCTGGGTGATC
CACACGGTGGGTCCCGTCTGGTCGTCCACCGAGGACCGCTCGGACCTGCTGGCCTCCTGC
TACCGCGAGTCCCTGCGCCTGGCAGGCGAACTCGGCGCCCGTACGGTGGCGTTCCCCGCC
CTCTCCACCGGCGTCTACCGCTGGCCGATGGGGGACGCGGCCCGCATTGCCGTGGAGACG
GTACGCACCACCCCGACCGCCGTCGAGGAGGTCCGTTTCGTCCTCTTCGACACCCACGCG
TACGACACGTTCGCCCGGGAACTCGGCGACGCCGGTCACGCCGGTCACGCCGGTCACCCC
GGTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002589 Appr-1-p processing (Domain)
 [3-137]  2.39999798157265e-54 SM00506
SM00506   A1pp
 [20-137]  3.09999999999998e-39 PF01661
PF01661   Macro
 [1-172]  PS51154
PS51154   MACRO
SignalP
 [1-29]  0.052 Signal
Bacteria, Gram-negative   
TMHMM No significant hit