close all open/close all

CDS information : Nogl_00050


close this sectionLocation

Organism
StrainATCC 27451 (=NBRC 13445)
Entry nameNogalamycin
Contig
Start / Stop / Direction5,887 / 4,469 / - [in whole cluster]
5,887 / 4,469 / - [in contig]
Locationcomplement(4469..5887) [in whole cluster]
complement(4469..5887) [in contig]
TypeCDS
Length1,419 bp (472 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative dehydrogenase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in nogalamycin biosynthesis.
Note (GenBank)
  • Orf6

close this sectionSequence

selected fasta
>[putative dehydrogenase]
MPSMLDAVVVGAGPNGLTAAVELARRGFSVALFEAKSTVGGGARTEELTLPGFRHDPCSA
AHPLGVNSPAFRSLPLDRYGLEWLHAPLPMAHPFPDGTAAVLSRSVAETAASFGPRDAGP
YRRLVEPLLARWDTLVQDFMSLPLTALPRDPVTLARFGLAGLPPSTWLMRRFKDERFKTL
FAGLVAHVMAPLGGLATSAVGLVFALSAHARGWPVARGGSQAVSDALAAYLRDLGGAVHT
DFEVKRLDDLPPARAYVFDTSPAALARMPASATTTANYRYGPSVFKIDYALDGPVPWTAP
EARSAGTVQIGASRAEIGTALRAAAREGRAPERPFMITVQPSVADPTRAPEGKHVFWAYG
HVPNGWTGDLTEAIERQLERFAPGFRDRVLARATAGPAEMAVRNANYVGGDIACGATSGL
QLLLRPRLSLFPYHTPHPAVFLCSSATPPGPGVHGMSGHNAAKAVWRRLRQG
selected fasta
>[putative dehydrogenase]
GTGCCGTCGATGCTCGATGCGGTCGTGGTGGGTGCGGGGCCGAACGGACTGACCGCCGCG
GTGGAGCTGGCCCGCCGCGGCTTCTCCGTGGCCCTGTTCGAGGCGAAGTCCACGGTGGGC
GGCGGCGCCCGCACGGAGGAGCTGACGCTGCCCGGCTTCCGGCACGACCCGTGCTCGGCC
GCGCACCCCCTCGGGGTCAACTCCCCGGCGTTCCGCTCCCTCCCCCTCGACCGGTACGGC
CTTGAGTGGCTGCACGCCCCGCTGCCCATGGCCCACCCGTTCCCGGACGGCACCGCGGCC
GTGCTGTCCCGTTCGGTGGCCGAGACCGCCGCCTCCTTCGGACCGCGCGACGCGGGCCCG
TACCGCAGGCTGGTCGAGCCCCTGCTCGCCCGCTGGGACACCCTGGTCCAGGACTTCATG
TCCCTGCCGCTGACCGCGCTGCCCCGCGACCCGGTCACCCTCGCCCGCTTCGGCCTGGCC
GGGCTCCCGCCGTCCACCTGGCTGATGCGCCGCTTCAAGGACGAGCGGTTCAAGACCCTC
TTCGCCGGCCTCGTCGCCCATGTGATGGCACCGCTGGGCGGCCTCGCCACCAGCGCCGTC
GGCCTGGTCTTCGCCCTGTCCGCGCACGCCCGCGGCTGGCCGGTGGCCCGCGGCGGTTCC
CAGGCCGTCTCCGACGCCCTCGCCGCGTATCTGAGGGATCTCGGCGGTGCGGTGCACACC
GACTTCGAGGTCAAGCGCCTGGACGACCTGCCGCCCGCGCGCGCGTACGTCTTCGACACC
TCGCCCGCCGCGCTCGCCCGCATGCCGGCCTCGGCGACTACTACGGCGAACTACCGCTAC
GGCCCCAGCGTCTTCAAGATCGACTATGCGCTGGACGGCCCGGTGCCGTGGACCGCGCCC
GAGGCCCGGAGCGCCGGTACCGTCCAGATCGGCGCGAGCCGGGCCGAGATCGGCACGGCC
CTGCGCGCCGCCGCCCGCGAGGGACGCGCACCCGAGCGGCCGTTCATGATCACCGTGCAG
CCGAGCGTGGCCGACCCCACCCGGGCCCCCGAGGGCAAGCACGTCTTCTGGGCGTACGGC
CATGTGCCGAACGGCTGGACCGGGGACCTCACCGAGGCCATAGAACGCCAGCTGGAGCGC
TTCGCCCCCGGCTTCCGCGACCGGGTGCTCGCCCGCGCGACGGCCGGGCCCGCCGAGATG
GCCGTCCGCAACGCCAACTACGTCGGCGGGGACATCGCCTGCGGCGCGACCTCCGGACTC
CAGCTGCTGCTGCGGCCCAGACTGTCCCTGTTCCCGTACCACACCCCCCACCCGGCCGTC
TTCCTCTGCTCCTCGGCCACGCCGCCGGGACCCGGCGTGCACGGCATGTCGGGCCACAAT
GCGGCCAAGGCGGTCTGGCGGAGACTGAGACAGGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP
 [1-19]  0.138 Signal
Eukaryota   
 [1-12]  0.154 Signal
Bacteria, Gram-negative   
TMHMM No significant hit