close all open/close all

CDS information : Nogl_00060


close this sectionLocation

Organism
StrainATCC 27451 (=NBRC 13445)
Entry nameNogalamycin
Contig
Start / Stop / Direction6,821 / 5,976 / - [in whole cluster]
6,821 / 5,976 / - [in contig]
Locationcomplement(5976..6821) [in whole cluster]
complement(5976..6821) [in contig]
TypeCDS
Length846 bp (281 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative inositol monophosphatase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in nogalamycin biosynthesis.
Note (GenBank)
  • Orf5

close this sectionSequence

selected fasta
>[putative inositol monophosphatase]
MIEETETIEEFLARRSADVEEAVRKAAEAEILPRFRRLAAHEVDQKSGPHDLVTDADRLA
ELRLTEDLGALLPGSVVVGEEAVHANPVVYEALQGDTPVWIVDPVDGTRQFVHGDDGFCT
LVALAHRGTVVASWTYAAARDRFATAVRGRGAFLDGERLFAGPPEPGRDLVVATSHPDYT
TDEQKRALRALWTDGLAPRPCGSAGLEYLAVARGELDAVAFSWEAAWDHAAGLLLVEEAG
GTHLTLTGEPFRVTGGNALPFTAARDAATARRVAGLLRTAS
selected fasta
>[putative inositol monophosphatase]
ATGATCGAAGAGACGGAAACCATCGAGGAGTTTCTCGCCCGCCGCTCGGCCGACGTGGAG
GAGGCGGTCCGCAAGGCCGCCGAGGCCGAGATCCTGCCCCGCTTCCGCCGCCTCGCCGCG
CACGAGGTGGACCAGAAGAGCGGCCCGCACGACCTGGTCACGGACGCCGACCGGCTCGCC
GAGCTACGGCTCACCGAGGACCTCGGCGCGCTGCTGCCCGGCTCCGTGGTGGTCGGCGAG
GAAGCGGTGCACGCCAACCCGGTGGTCTACGAGGCGCTCCAGGGCGACACCCCGGTCTGG
ATCGTCGACCCGGTCGACGGCACCCGCCAGTTCGTCCACGGCGACGACGGCTTCTGCACC
CTGGTGGCCCTCGCCCACCGCGGCACCGTGGTCGCCTCCTGGACCTACGCCGCCGCGCGC
GACCGGTTCGCCACCGCCGTCCGCGGCCGGGGCGCCTTCCTCGACGGCGAGCGGCTGTTC
GCCGGCCCGCCCGAGCCCGGCCGGGACCTGGTCGTCGCCACCTCCCACCCGGACTACACC
ACCGACGAGCAGAAGCGCGCGCTGCGCGCCCTGTGGACCGACGGCCTCGCCCCGCGCCCG
TGCGGCTCCGCGGGCCTGGAGTACCTCGCGGTCGCCCGGGGCGAGCTGGACGCCGTCGCG
TTCTCCTGGGAGGCCGCCTGGGACCACGCGGCCGGACTGCTCCTGGTCGAGGAGGCCGGC
GGCACGCACCTCACCCTGACCGGCGAGCCGTTCCGCGTCACCGGCGGCAACGCCCTGCCG
TTCACCGCCGCGCGGGACGCCGCCACCGCCCGCCGGGTGGCCGGGCTGCTGCGCACCGCC
TCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000760 Inositol monophosphatase (Family)
 [20-253]  4.10000000000004e-59 PF00459
PF00459   Inositol_P
 [51-71]  4.90001027782405e-22 PR00377 [100-116]  4.90001027782405e-22 PR00377 [149-172]  4.90001027782405e-22 PR00377 [193-214]  4.90001027782405e-22 PR00377 [224-248]  4.90001027782405e-22 PR00377
PR00377   IMPHPHTASES
IPR020550 Inositol monophosphatase, conserved site (Conserved_site)
 [227-241]  PS00630
PS00630   IMP_2
IPR020583 Inositol monophosphatase, metal-binding site (Binding_site)
 [100-113]  PS00629
PS00629   IMP_1
SignalP No significant hit
TMHMM No significant hit