close all open/close all

CDS information : Nogl_00070


close this sectionLocation

Organism
StrainATCC 27451 (=NBRC 13445)
Entry nameNogalamycin
Contig
Start / Stop / Direction8,955 / 7,090 / - [in whole cluster]
8,955 / 7,090 / - [in contig]
Locationcomplement(7090..8955) [in whole cluster]
complement(7090..8955) [in contig]
TypeCDS
Length1,866 bp (621 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative gamma-glutamyl transferase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in nogalamycin biosynthesis.
Note (GenBank)
  • Orf4

close this sectionSequence

selected fasta
>[putative gamma-glutamyl transferase]
MRFTTRPTLQGTFGMVSSTHWLASQSAMAVLEDGGNAFDAAVAGAFVLHVVEPHLNGPAG
EVPILLAPAGGAVRVLCGQGVAPAGATPAHYRRLGLDLVPGTGPLAAAVPGAFDAWLLLL
RDHGTKPLDAVLKYAIGYAEHGHAPVENVGATVASVRRLFETEWPSSAEVYLPGGRPPRP
GTLLRNPALAATWKRLLAETAGAGDREARIDAAREVWRSGFIAEALVRQSRRPTMDTSGE
RHTGTLTEADLAGWSAHYETPVTYDWNGWTVCKAGPWSQGPVLLQQLALLPAELPAPGSA
DYVHLLVEGCKLAMADREAWYGDAAEVPLADLLSDAYNAGRRALIGAKASYDLLPGSPGG
RPPRLPALAHARVPADTRPGFDPMGAGEPTVAPLPGAPTLAEATGQAQVTGEADVAADGS
TRGDTCHLDVVDRWGNMIAATPSGGWLQSNPVVPELGFPLGTRLQMTWLEEGLPGTLTPG
RRPRTTLTPSLALRDGVPVLAFGTPGGDQQDQWQLHFFLAAALGAPVRGGLDLQGAIDAP
NWHNDSFPGSFHPRRRRPGSVTVESRMDPGVIEELRRRGHDVTVGPAWSEGRLCAVARDP
ETGILSAAANPRGMQGYAVGR
selected fasta
>[putative gamma-glutamyl transferase]
ATGCGGTTCACGACCCGACCCACCCTTCAAGGCACCTTCGGCATGGTCTCCTCCACACAC
TGGCTGGCCTCCCAGTCGGCGATGGCGGTGCTGGAGGACGGCGGCAACGCCTTCGACGCG
GCCGTCGCCGGCGCGTTCGTGCTGCACGTCGTGGAGCCGCATCTGAACGGGCCGGCCGGC
GAGGTGCCGATCCTGCTCGCCCCCGCGGGCGGCGCCGTGCGCGTGCTGTGCGGACAGGGC
GTCGCCCCGGCCGGCGCCACCCCGGCCCACTACCGGCGCCTCGGGCTGGACCTCGTGCCC
GGCACCGGACCGCTCGCCGCCGCCGTGCCCGGCGCCTTCGACGCCTGGCTGCTTTTGCTG
CGCGACCACGGCACCAAGCCCCTGGACGCGGTCCTCAAGTACGCCATCGGCTACGCCGAG
CACGGGCACGCGCCCGTGGAGAACGTCGGCGCGACCGTGGCGAGCGTACGGCGGCTGTTC
GAGACCGAGTGGCCGTCGTCGGCCGAGGTGTACCTGCCCGGCGGCCGGCCGCCCCGGCCC
GGGACGCTGCTGCGCAACCCCGCGCTCGCCGCCACCTGGAAGCGGCTGCTGGCCGAGACC
GCGGGCGCCGGCGACCGGGAGGCGCGGATCGACGCCGCGCGCGAGGTGTGGCGCTCCGGC
TTCATCGCCGAGGCCCTGGTACGGCAGTCCCGGCGGCCCACCATGGACACCAGCGGCGAA
CGGCACACCGGCACCCTCACCGAGGCCGACCTGGCCGGCTGGTCCGCCCACTACGAGACA
CCGGTGACGTACGACTGGAACGGCTGGACCGTGTGCAAGGCCGGCCCCTGGAGCCAGGGC
CCGGTGCTCCTCCAGCAGCTCGCCCTGCTCCCGGCCGAGCTGCCCGCACCGGGCTCCGCC
GACTACGTCCACCTGCTGGTCGAGGGCTGCAAGCTCGCCATGGCCGACCGCGAGGCCTGG
TACGGCGACGCCGCCGAGGTGCCCCTCGCCGACCTGCTGTCGGACGCCTACAACGCCGGC
CGGCGGGCCCTGATCGGCGCGAAGGCCTCCTACGACCTGCTCCCCGGCAGCCCCGGCGGA
AGGCCCCCCAGGCTGCCCGCGCTGGCGCACGCGCGCGTGCCGGCCGACACGCGGCCCGGC
TTCGACCCGATGGGCGCCGGGGAGCCGACCGTCGCCCCGCTGCCCGGGGCGCCCACCCTC
GCCGAGGCCACCGGTCAGGCGCAGGTGACCGGTGAGGCCGACGTGGCCGCCGACGGCTCG
ACCCGGGGCGACACCTGCCACCTGGACGTCGTCGACCGCTGGGGCAACATGATCGCGGCC
ACGCCCAGCGGCGGCTGGCTCCAGTCCAACCCCGTGGTCCCCGAACTCGGCTTCCCGCTC
GGCACCCGGCTGCAGATGACCTGGCTGGAGGAGGGCCTGCCGGGCACCCTCACCCCCGGC
CGCCGCCCCCGCACCACCCTCACCCCCTCCCTCGCCCTGCGCGACGGGGTACCGGTCCTG
GCGTTCGGCACGCCCGGCGGGGACCAGCAGGACCAGTGGCAGCTGCACTTCTTCCTGGCC
GCCGCCCTGGGTGCCCCCGTCCGCGGCGGCCTCGACCTCCAGGGCGCCATCGACGCCCCC
AACTGGCACAACGACAGCTTCCCCGGCTCCTTCCACCCGCGCCGCCGGCGCCCCGGCAGC
GTCACCGTGGAGTCCCGCATGGACCCCGGTGTGATCGAGGAGCTGCGGCGGCGCGGCCAC
GACGTCACCGTCGGCCCCGCCTGGTCCGAGGGCCGGCTGTGCGCGGTGGCCCGGGACCCG
GAGACCGGCATCCTCTCGGCGGCGGCGAACCCGCGCGGGATGCAGGGTTACGCGGTCGGC
CGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000101 Gamma-glutamyltranspeptidase (Family)
 [36-61]  6.19998763505952e-18 PR01210 [106-124]  6.19998763505952e-18 PR01210 [124-143]  6.19998763505952e-18 PR01210 [274-293]  6.19998763505952e-18 PR01210 [479-494]  6.19998763505952e-18 PR01210
PR01210   GGTRANSPTASE
 [28-615]  PF01019
PF01019   G_glu_transpept
SignalP
 [1-29]  0.955 Signal
Bacteria, Gram-negative   
 [1-29]  0.595 Signal
Eukaryota   
 [1-29]  0.403 Signal
Bacteria, Gram-positive   
TMHMM No significant hit