close all open/close all

CDS information : Nogl_00080


close this sectionLocation

Organism
StrainATCC 27451 (=NBRC 13445)
Entry nameNogalamycin
Contig
Start / Stop / Direction9,291 / 10,127 / + [in whole cluster]
9,291 / 10,127 / + [in contig]
Location9291..10127 [in whole cluster]
9291..10127 [in contig]
TypeCDS
Length837 bp (278 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative demethoxynogalose O-methyltransferase
Product (GenBank)SnogM
Gene
Gene (GenBank)snogM
EC number2.1.1.-
Keyword
  • nogalose
Note
Note (GenBank)
  • putative O-methyltransferase
Reference
ACC
PmId
[11683270] The entire nogalamycin biosynthetic gene cluster of Streptomyces nogalater: characterization of a 20-kb DNA region and generation of hybrid structures. (Mol Genet Genomics. , 2001)
[22120896] Identification of late-stage glycosylation steps in the biosynthetic pathway of the anthracycline nogalamycin. (Chembiochem. , 2012)
Related Reference
ACC
Q9X5Q9
PmId
[10099135] Molecular characterization and analysis of the biosynthetic gene cluster for the antitumor antibiotic mitomycin C from Streptomyces lavendulae NRRL 2564. (Chem Biol. , 1999)
[11439066] Mapping the mitomycin biosynthetic pathway by functional analysis of the MitM aziridine N-methyltransferase. (J Am Chem Soc. , 2001)
ACC
Q8KI52
PmId
[12619684] Characterization of the biosynthetic gene cluster of rebeccamycin from Lechevalieria aerocolonigenes ATCC 39243. (Biosci Biotechnol Biochem. , 2003)
ACC
O52570
NITE
Rifam_00560
PmId
[12623077] Isolation and characterization of 27-O-demethylrifamycin SV methyltransferase provides new insights into the post-PKS modification steps during the biosynthesis of the antitubercular drug rifamycin B by Amycolatopsis mediterranei S699. (Arch Biochem Biophys. , 2003)

close this sectionSequence

selected fasta
>putative demethoxynogalose O-methyltransferase [SnogM]
MTNSGTRPQEVADFYDGSSRLIAELNGGSLHFGCWDSLPADAGMDRASQRLTEMMTERIE
VGPGQRVLDIGCGTGAPAVQLARATGAEVVGITISPEQVRLATAHAEREGVAERVTFRCA
DASAELPFPADSFDAVWFFESIFHLPDRLTALRRAAEVLRPGGRLALTDVLHNDETSPAA
QESLDEHAYTPLVGEPMRLSDYPPLLRQARLVPVECRDISELTVGRTLECMHRTLDENRE
RFVERYGSELVDQFSTAVPLLDAVEFGYGIVTAARPDH
selected fasta
>putative demethoxynogalose O-methyltransferase [SnogM]
ATGACGAACTCCGGGACACGGCCGCAGGAGGTCGCGGACTTCTACGACGGCAGCAGCCGT
CTGATCGCCGAACTGAACGGAGGGAGCCTGCACTTCGGCTGCTGGGACTCGCTGCCGGCC
GACGCCGGCATGGACCGGGCGTCGCAGCGGCTCACCGAGATGATGACGGAGCGGATCGAG
GTCGGCCCCGGACAGCGGGTGCTGGACATCGGCTGCGGCACCGGCGCGCCGGCGGTGCAA
CTGGCCCGGGCCACCGGCGCCGAGGTCGTGGGCATCACGATCAGCCCGGAGCAGGTCCGG
CTGGCCACGGCACACGCCGAGCGGGAGGGAGTCGCCGAGCGGGTCACCTTCCGGTGCGCG
GACGCCTCCGCGGAACTCCCCTTCCCCGCCGACTCGTTCGACGCGGTCTGGTTCTTCGAG
TCGATCTTCCACCTTCCGGACCGGCTGACCGCGCTGCGCCGGGCGGCCGAGGTCCTGCGG
CCGGGCGGGCGACTGGCCCTCACCGACGTCCTGCACAACGACGAAACCTCCCCCGCGGCC
CAGGAGTCGCTGGACGAGCACGCGTACACGCCGTTGGTCGGCGAGCCGATGCGGCTGTCC
GACTATCCGCCTCTGCTGCGGCAGGCCCGCCTCGTCCCCGTCGAGTGCCGCGACATCAGC
GAACTGACCGTGGGGCGCACGCTGGAGTGCATGCACCGCACGCTCGACGAGAACCGCGAG
CGCTTCGTCGAGCGGTACGGCAGCGAGCTGGTCGATCAGTTCTCCACGGCCGTCCCGCTC
CTGGACGCGGTCGAGTTCGGCTACGGCATCGTCACCGCGGCCCGGCCGGATCACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013216 Methyltransferase type 11 (Domain)
 [68-166]  1e-23 PF08241
PF08241   Methyltransf_11
SignalP No significant hit
TMHMM No significant hit