close all open/close all

CDS information : Nogl_00090


close this sectionLocation

Organism
StrainATCC 27451 (=NBRC 13445)
Entry nameNogalamycin
Contig
Start / Stop / Direction10,221 / 11,042 / + [in whole cluster]
10,221 / 11,042 / + [in contig]
Location10221..11042 [in whole cluster]
10221..11042 [in contig]
TypeCDS
Length822 bp (273 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative demethoxynogalose O-methyltransferase
Product (GenBank)SnogL
Gene
Gene (GenBank)snogL
EC number2.1.1.-
Keyword
  • nogalose
Note
Note (GenBank)
  • putative O-methyltransferase
Reference
ACC
PmId
[11683270] The entire nogalamycin biosynthetic gene cluster of Streptomyces nogalater: characterization of a 20-kb DNA region and generation of hybrid structures. (Mol Genet Genomics. , 2001)
[22120896] Identification of late-stage glycosylation steps in the biosynthetic pathway of the anthracycline nogalamycin. (Chembiochem. , 2012)
Related Reference
ACC
Q49492
PmId
[8163162] A gene encoding mycinamicin III O-methyltransferase from Micromonospora griseorubida. (Gene. , 1994)
[19415708] Functional analysis of MycE and MycF, two O-methyltransferases involved in the biosynthesis of mycinamicin macrolide antibiotics. (Chembiochem. , 2009)
[20158522] Gene targeting for O-methyltransferase genes, mycE and mycF, on the chromosome of Micromonospora griseorubida producing mycinamicin with a disruption cassette containing the bacteriophage phi C31 attB attachment site. (FEMS Microbiol Lett. , 2010)
[25692963] Structural basis of substrate specificity and regiochemistry in the MycF/TylF family of sugar O-methyltransferases. (ACS Chem Biol. , 2015)

close this sectionSequence

selected fasta
>putative demethoxynogalose O-methyltransferase [SnogL]
MGNTPIELYLDLMSRTVSNTIYEDPQIDPRRYWELLRERDGDGTGPVMDGPGNWSAYDSE
GREQGSVWPRDAHTMVGMRRLRNVRECAERVLADGVPGDFMETGVWRGGTCIFMRAVLAA
YEVSDRVVWVADSFAGIPAPDLDRYPQDEEARGIESVNEVVGVPLETVRGNFDRYGLLDD
QVRFLPGRFCDTLPEAPVERLALLRLDGDLYESTMDALVSMYPKLSPGGYLIVDDYHALD
VCKKAVHDYRDQHGIDDPITDIDWSGAYWRKSA
selected fasta
>putative demethoxynogalose O-methyltransferase [SnogL]
ATGGGGAACACGCCGATCGAGCTCTACCTGGATCTGATGTCACGCACCGTCAGCAACACC
ATCTACGAGGATCCGCAGATCGACCCGCGCCGCTACTGGGAGCTGCTGCGGGAACGGGAC
GGCGACGGGACCGGACCGGTCATGGACGGCCCCGGCAATTGGAGTGCCTACGACAGCGAG
GGACGCGAGCAGGGCAGCGTCTGGCCGCGCGACGCCCACACCATGGTCGGCATGCGCAGG
CTCAGGAACGTACGGGAATGCGCGGAGCGGGTCCTGGCCGACGGGGTGCCGGGCGACTTC
ATGGAGACCGGCGTGTGGCGCGGCGGCACCTGCATCTTCATGCGGGCGGTGCTGGCGGCG
TACGAGGTCAGCGACCGCGTGGTGTGGGTCGCCGACTCCTTCGCCGGTATCCCCGCGCCC
GACCTGGACCGCTATCCGCAGGACGAGGAGGCGCGGGGCATCGAGTCGGTCAACGAGGTG
GTGGGCGTGCCCCTGGAGACCGTCCGCGGCAACTTCGACCGCTACGGGCTGCTCGACGAC
CAGGTGCGGTTCCTCCCGGGACGGTTCTGCGACACGCTGCCCGAGGCCCCCGTGGAGCGG
CTGGCGCTGCTGCGTCTGGACGGGGATCTGTACGAATCCACGATGGACGCCCTGGTGTCG
ATGTACCCGAAGCTGTCGCCCGGCGGCTATCTGATCGTGGACGACTACCACGCCCTGGAC
GTCTGCAAGAAGGCCGTGCACGACTATCGGGACCAGCACGGCATCGACGACCCGATCACG
GACATCGACTGGTCGGGGGCCTACTGGCGCAAGAGCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR008884 Macrocin-O-methyltransferase (Family)
 [5-272]  1.5e-123 PF05711
PF05711   TylF
SignalP No significant hit
TMHMM No significant hit