close all open/close all

CDS information : Nogl_00100


close this sectionLocation

Organism
StrainATCC 27451 (=NBRC 13445)
Entry nameNogalamycin
Contig
Start / Stop / Direction12,324 / 11,110 / - [in whole cluster]
12,324 / 11,110 / - [in contig]
Locationcomplement(11110..12324) [in whole cluster]
complement(11110..12324) [in contig]
TypeCDS
Length1,215 bp (404 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)
GenesnoT
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
Reference
PmId
[11683270] The entire nogalamycin biosynthetic gene cluster of Streptomyces nogalater: characterization of a 20-kb DNA region and generation of hybrid structures. (Mol Genet Genomics. , 2001)
Related Reference
ACC
P0ABR5
PmId
[9603882] Characterization of the hca cluster encoding the dioxygenolytic pathway for initial catabolism of 3-phenylpropionic acid in Escherichia coli K-12. (J Bacteriol. , 1998)
[9205837] Construction of a contiguous 874-kb sequence of the Escherichia coli -K12 genome corresponding to 50.0-68.8 min on the linkage map and analysis of its sequence features. (DNA Res. , 1997)
Family/Domain
FD
IPR017941

close this sectionSequence

selected fasta
>putative oxidoreductase
MTLHQTGPAAPRPDSSTTPPLSPETADLLAELGGYLVPDPPALSLPPRAFASGELYELER
EKVFGRSWLLVAHTDQLAGPGAYVALTVAGEPVVITRGDDGALHAMSPICRHRMMPVVEP
GTGRTDRFTCPYHLWRYGLDGRLIGATFMRRNEAFDPAGCRLPQFAVEEWHGFVFVNLDP
AAEALAPHLARIESDLVNYRLDDMVLAGEWAEEWHCNWKIAVENAHENYHVMGFHPETLE
PSTPGRSDTDLRDDTPWALRFRIPFTEPQQPSLLSLTEDEKAHLYDFFVFPTGSLAAAGE
AVIWLSMLPLSLDRTQVRGGMLVPAARVKDLGEAERKEMRQGIESYSAMVNAEDRRGLEA
VQRSVGSRFAARGHLSPKEPAVVSFYRNLARALLRGDDEWPGAL
selected fasta
>putative oxidoreductase
TTGACCCTCCATCAGACCGGCCCGGCGGCCCCGCGGCCGGACTCCTCCACCACACCCCCT
CTGTCGCCGGAGACCGCGGACCTGCTCGCCGAACTCGGTGGCTACCTGGTCCCGGACCCG
CCCGCCCTCAGCCTGCCGCCCCGGGCGTTCGCCTCCGGTGAGCTGTACGAGCTGGAGCGG
GAGAAGGTCTTCGGCCGTTCCTGGCTTCTCGTCGCGCACACCGACCAACTCGCCGGCCCC
GGTGCCTACGTCGCCCTCACCGTCGCGGGCGAACCCGTCGTCATCACGCGCGGCGACGAC
GGCGCGCTGCACGCGATGTCACCGATCTGCCGCCACCGCATGATGCCGGTCGTCGAACCG
GGCACCGGCCGCACCGACCGGTTCACCTGCCCGTACCACCTGTGGCGCTACGGACTGGAC
GGCCGGTTGATCGGCGCCACCTTCATGCGGCGCAACGAGGCGTTCGACCCCGCCGGCTGC
CGACTGCCGCAGTTCGCCGTGGAAGAGTGGCACGGGTTCGTCTTCGTCAACCTCGACCCC
GCGGCGGAAGCCCTGGCTCCGCACCTCGCCCGAATCGAAAGCGACCTGGTCAACTACCGC
CTGGACGACATGGTACTGGCCGGGGAATGGGCCGAGGAGTGGCACTGCAACTGGAAGATC
GCCGTGGAGAACGCGCACGAGAACTACCACGTGATGGGCTTCCACCCCGAGACCCTGGAA
CCGTCCACCCCGGGCCGCTCCGACACGGATCTGCGCGACGACACGCCGTGGGCGCTGCGT
TTCCGCATCCCGTTCACCGAGCCCCAGCAGCCGTCCCTCCTCTCCCTGACCGAGGACGAG
AAGGCTCACCTGTACGACTTCTTCGTCTTCCCCACCGGGAGCCTCGCCGCCGCCGGGGAG
GCGGTGATCTGGCTGAGCATGCTCCCGTTGTCCCTCGACCGCACCCAGGTCCGCGGGGGC
ATGCTGGTCCCCGCCGCCCGGGTCAAGGACCTCGGTGAGGCCGAACGGAAGGAGATGCGG
CAGGGCATCGAGTCGTACTCCGCGATGGTCAACGCGGAGGACCGGCGCGGCCTGGAGGCC
GTGCAGCGGTCCGTGGGCTCCCGGTTCGCCGCGCGCGGCCACCTCAGCCCCAAGGAGCCG
GCCGTCGTCTCCTTCTACCGGAACCTGGCGCGCGCCCTGCTGCGTGGCGACGACGAGTGG
CCCGGCGCCCTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001663 Aromatic-ring-hydroxylating dioxygenase, alpha subunit (Domain)
 [52-77]  6e-26 PR00090 [82-97]  6e-26 PR00090 [103-123]  6e-26 PR00090 [124-144]  6e-26 PR00090 [165-191]  6e-26 PR00090 [202-224]  6e-26 PR00090
PR00090   RNGDIOXGNASE
IPR015879 Aromatic-ring-hydroxylating dioxygenase, alpha subunit, C-terminal domain (Domain)
 [201-393]  1.3e-29 PF00848
PF00848   Ring_hydroxyl_A
IPR017941 Rieske [2Fe-2S] iron-sulphur domain (Domain)
 [68-176]  33.154 PS51296
PS51296   RIESKE
 [66-175]  1.3e-33 G3DSA:2.102.10.10
G3DSA:2.102.10.10   no description
 [67-161]  6.9e-18 PF00355
PF00355   Rieske
 [28-181]  1.7e-46 SSF50022
SSF50022   ISP domain
SignalP No significant hit
TMHMM No significant hit