close all open/close all

CDS information : Nogl_00120


close this sectionLocation

Organism
StrainATCC 27451 (=NBRC 13445)
Entry nameNogalamycin
Contig
Start / Stop / Direction13,208 / 12,639 / - [in whole cluster]
571 / 2 / - [in contig]
Locationcomplement(12639..13208) [in whole cluster]
complement(2..571) [in contig]
TypeCDS
Length570 bp (189 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
ProductC-4'' epimerase(fragment)
Product (GenBank)SnoN
Gene
Gene (GenBank)snoN
EC number
Keyword
  • nogalamine
Note
Note (GenBank)
Reference
ACC
PmId
[11683270] The entire nogalamycin biosynthetic gene cluster of Streptomyces nogalater: characterization of a 20-kb DNA region and generation of hybrid structures. (Mol Genet Genomics. , 2001)
[27114534] Divergent non-heme iron enzymes in the nogalamycin biosynthetic pathway. (Proc Natl Acad Sci U S A. , 2016)

close this sectionSequence

selected fasta
>C-4'' epimerase(fragment) [SnoN]
MQETEPGVPADLPAESDPAALERLAARYRRDGYVHVPGVLDAGEVAEYLAEARRLLAHEE
SVRWGSGAGTVMDYVADAQLGSDTMRRLATHPRIAALAEYLAGSPLRLFKLEVLLKENKE
KDASVPTAPHHDAFAFPFSTAGTALTAWVALVDVPVERGCMTFVPGSHLLPDPDTGDEPW
AGAFTRPGEI
selected fasta
>C-4'' epimerase(fragment) [SnoN]
GTGCAGGAAACCGAACCCGGCGTCCCCGCGGACCTGCCCGCCGAGAGCGACCCTGCCGCC
CTGGAGCGCCTCGCCGCACGGTACCGGCGGGACGGCTACGTCCACGTCCCCGGCGTCCTC
GACGCCGGGGAGGTCGCCGAATACCTGGCCGAGGCCCGTCGGCTCCTCGCCCACGAGGAG
TCCGTGCGCTGGGGCTCCGGCGCCGGCACCGTCATGGACTACGTCGCCGACGCCCAGCTC
GGCAGCGACACGATGCGCCGCCTTGCCACCCACCCGCGCATCGCCGCCCTCGCCGAGTAC
CTGGCCGGCTCGCCCCTGAGGCTGTTCAAGCTGGAGGTGCTGCTCAAGGAGAACAAGGAG
AAGGACGCCTCGGTCCCCACCGCCCCGCACCACGATGCGTTCGCCTTCCCGTTCTCCACC
GCCGGCACCGCCCTGACGGCGTGGGTCGCGCTGGTCGACGTCCCGGTGGAACGCGGCTGC
ATGACCTTCGTCCCCGGATCACACCTGCTGCCGGATCCCGATACCGGCGACGAGCCGTGG
GCCGGGGCCTTCACCCGGCCGGGAGAGATC

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR008775 Phytanoyl-CoA dioxygenase (Family)
 [28-173]  3.60000000000001e-25 PF05721
PF05721   PhyH
SignalP No significant hit
TMHMM No significant hit