close all open/close all

CDS information : Nogl_00130


close this sectionLocation

Organism
StrainATCC 27451 (=NBRC 13445)
Entry nameNogalamycin
Contig
Start / Stop / Direction14,126 / 13,281 / - [in whole cluster]
1,489 / 644 / - [in contig]
Locationcomplement(13281..14126) [in whole cluster]
complement(644..1489) [in contig]
TypeCDS
Length846 bp (281 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative nogalaviketone C-7 ketoreductase
Product (GenBank)C-7 ketoreductase
Gene
Gene (GenBank)snoaF
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[11683270] The entire nogalamycin biosynthetic gene cluster of Streptomyces nogalater: characterization of a 20-kb DNA region and generation of hybrid structures. (Mol Genet Genomics. , 2001)
Related Reference
ACC
Q53882
NITE
Dauno_00060
PmId
[8655529] Cloning, sequencing, and analysis of aklaviketone reductase from Streptomyces sp. strain C5. (J Bacteriol. , 1996)

close this sectionSequence

selected fasta
>putative nogalaviketone C-7 ketoreductase [C-7 ketoreductase]
MRAMTDSTGPRPVPAMSPAPSPTPSPGPAPGSEPAPLAVIVTGGGSGIGRATARAFAAQG
AKVLVVGRTEDALAQTAEGCADMRVLVADVASPDGPQAVVNAALREFGRIDVLVNNAAVA
GMETLQTVDRDAVARQFGTNLTAPLFLVQSALGALEKSRGIVVNVGTAATLGLRAAPTGA
LYGASKVALDYLTRTWAVELAPRGIRVVGVAPGVIDTGIGVRMGMTPEGYREFLTGMGGR
VPVGRVGRPEDVAWWIVQLARPEAGYATGMVVPVDGGLSLV
selected fasta
>putative nogalaviketone C-7 ketoreductase [C-7 ketoreductase]
GTGCGAGCCATGACTGACTCGACAGGTCCCCGCCCGGTGCCCGCCATGTCACCCGCCCCC
AGCCCCACGCCTTCCCCCGGCCCCGCCCCCGGGAGCGAACCCGCGCCGCTCGCCGTGATC
GTCACCGGCGGCGGTTCGGGTATCGGCCGGGCCACCGCCCGCGCCTTCGCCGCTCAGGGT
GCGAAGGTGCTCGTCGTCGGCCGTACCGAGGACGCGCTCGCGCAGACCGCCGAGGGCTGT
GCGGACATGCGTGTGCTCGTCGCCGACGTGGCCTCGCCCGACGGGCCGCAGGCGGTCGTC
AACGCCGCCCTGCGGGAGTTCGGGAGGATCGACGTCCTGGTCAACAACGCTGCCGTGGCG
GGCATGGAGACCCTGCAGACCGTCGACCGGGACGCCGTGGCACGGCAGTTCGGCACCAAT
CTGACGGCTCCCCTCTTCCTCGTCCAGTCCGCACTCGGCGCGCTGGAGAAGTCGCGCGGC
ATCGTCGTCAACGTGGGGACCGCCGCGACCCTGGGCCTGCGCGCCGCCCCGACCGGCGCG
CTGTACGGGGCGAGCAAGGTGGCCCTCGACTACCTGACCCGGACCTGGGCCGTCGAACTG
GCCCCCCGGGGCATCCGTGTCGTCGGCGTGGCACCCGGGGTGATCGACACGGGCATCGGC
GTCCGCATGGGCATGACCCCGGAGGGCTACCGGGAGTTCCTGACCGGCATGGGCGGCAGG
GTGCCCGTGGGCCGGGTCGGCCGTCCGGAGGACGTGGCCTGGTGGATCGTCCAGCTCGCC
CGCCCGGAGGCCGGCTACGCGACGGGCATGGTCGTCCCCGTCGACGGCGGGCTGTCGCTG
GTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [108-119]  1.69999922284049e-09 PR00080 [160-168]  1.69999922284049e-09 PR00080 [182-201]  1.69999922284049e-09 PR00080
PR00080   SDRFAMILY
 [38-200]  7.59999999999998e-26 PF00106
PF00106   adh_short
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [38-55]  6.89998448199219e-36 PR00081 [108-119]  6.89998448199219e-36 PR00081 [154-170]  6.89998448199219e-36 PR00081 [182-201]  6.89998448199219e-36 PR00081 [203-220]  6.89998448199219e-36 PR00081 [242-262]  6.89998448199219e-36 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [39-280]  5.50000000000008e-72 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR020904 Short-chain dehydrogenase/reductase, conserved site (Conserved_site)
 [169-197]  PS00061
PS00061   ADH_SHORT
SignalP
 [1-15]  0.535 Signal
Bacteria, Gram-negative   
TMHMM No significant hit