close all open/close all

CDS information : Nogl_00150


close this sectionLocation

Organism
StrainATCC 27451 (=NBRC 13445)
Entry nameNogalamycin
Contig
Start / Stop / Direction14,904 / 15,323 / + [in whole cluster]
2,267 / 2,686 / + [in contig]
Location14904..15323 [in whole cluster]
2267..2686 [in contig]
TypeCDS
Length420 bp (139 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.1 modification hydroxylation
ProductC-1 hydroxylase
Product (GenBank)SnoL
GenesnoaL2
Gene (GenBank)snoL
EC number
Keyword
  • two-component system
  • C-1 hydroxylate
Note
Note (GenBank)
Reference
ACC
PmId
[16650858] Crystal structures of SnoaL2 and AclR: two putative hydroxylases in the biosynthesis of aromatic polyketide antibiotics. (J Mol Biol. , 2006)
[11683270] The entire nogalamycin biosynthetic gene cluster of Streptomyces nogalater: characterization of a 20-kb DNA region and generation of hybrid structures. (Mol Genet Genomics. , 2001)
[22633406] SnoaW/SnoaL2: a different two-component monooxygenase. (Chem Biol. , 2012)
[22633415] Discovery of a two-component monooxygenase SnoaW/SnoaL2 involved in nogalamycin biosynthesis. (Chem Biol. , 2012)

close this sectionSequence

selected fasta
>C-1 hydroxylase [SnoL]
MSTTANKERCLEMVAAWNRWDVSGVVAHWAPDVVHYDDEDKPVSAEEVVRRMNSAVEAFP
DLRLDVRSIVGEGDRVMLRITCSATHQGVFMGIAPTGRKVRWTYLEELRFSEAGKVVEHW
DVFNFSPLFRDLGVVPDGL
selected fasta
>C-1 hydroxylase [SnoL]
ATGTCAACGACCGCGAACAAGGAACGCTGCCTGGAGATGGTGGCCGCATGGAACCGGTGG
GACGTCTCCGGGGTGGTCGCGCACTGGGCACCCGACGTCGTCCACTACGACGACGAGGAC
AAACCGGTGAGCGCCGAGGAGGTCGTACGGCGTATGAACAGCGCGGTGGAGGCCTTCCCG
GACCTTCGTCTGGACGTGCGGAGCATCGTGGGCGAGGGCGACCGCGTGATGCTGCGGATC
ACCTGCTCGGCCACGCACCAGGGCGTGTTCATGGGCATCGCCCCCACCGGCCGCAAGGTC
CGCTGGACCTACTTGGAGGAGCTGCGCTTCTCCGAAGCCGGCAAGGTCGTGGAGCACTGG
GACGTCTTCAACTTCTCCCCGCTGTTCCGGGACCTGGGCGTGGTGCCGGACGGACTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009959 Polyketide cyclase SnoaL-like domain (Domain)
 [13-132]  1.09999999999999e-36 PF07366
PF07366   SnoaL
 [12-119]  9.7e-21 PF12680
PF12680   SnoaL_2
SignalP
 [1-27]  0.145 Signal
Eukaryota   
TMHMM No significant hit